<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32840

Description Transcription elongation factor A protein 2
SequenceMMGKEEEIARIARRLDKMVTKKSAEGAMDLLRELKAMPVTLHLLQSTRVGMSVNALRKQSSDEEVVTLAKSLIKSWKKLLDASDAKARERRRGGSLPTSSSKEASEAQDPSRKRPELPRMPSTPRITTFPPVPVTCDAVRTKCREMLTAALQTDHDHVAIGADCECLAGQIEECIFRDVGNTDMKYKNRVRSRLSNLKDAKNPGLRRKVLCGAITPQQIAVMTSEEMASDELKEIRKAMTKEAIREHQMARTGGTQTDLFTCGKCRKKNCTYTQVQTRSSDEPMTTFVVCNECGNRWKFC
Length300
PositionUnknown
OrganismBos taurus (Bovine)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae> Bovinae> Bos.
Aromaticity0.03
Grand average of hydropathy-0.615
Instability index59.89
Isoelectric point9.38
Molecular weight33641.58
Publications









Function






Annotated function

Necessary for efficient RNA polymerase II transcription
elongation past template-encoded arresting sites. The arresting sites
in DNA have the property of trapping a certain fraction of elongating
RNA polymerases that pass through, resulting in locked ternary
complexes. Cleavage of the nascent transcript by S-II allows the
resumption of elongation from the new 3'-terminus (By similarity).



ECO:0000250	

GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
DNA binding	GO:0003677	IEA:UniProtKB-KW
zinc ion binding	GO:0008270	IEA:InterPro

GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro
transcription, DNA-templated	GO:0006351	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32840
No repeats found




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32840 with Med26 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KARERRRGGSLPTSSSKEASEAQDPSRKRPELPRMPSTPRITTFPP
86
131










Molecular Recognition Features






MoRF SequenceStartStop




NANANA