<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32835

Description F-box-like/WD repeat-containing protein TBL1Y
SequenceMSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPSALISILQKGLQYVEAEISINKDGTVFDSRPIESLSLIVAVIPDVVQMRQQAFGEKLTQQQASAAATEASAMAKAATMTPAAISQQNPPKNREATVNGEENGAHEINNHSKPMEIDGDVEIPPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTENGNLASTLGQHKGPIFALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMTFASCSTDMCIHVCRLGCDHPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATSNPNSSIMLASASFDSTVRLWDVEQGVCTHTLMKHQEPVYSVAFSPDGKYLASGSFDKYVHIWNTQSGSLVHSYQGTGGIFEVCWNARGDKVGASASDGSVCVLDL
Length522
PositionTail
OrganismHomo sapiens (Human)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo.
Aromaticity0.08
Grand average of hydropathy-0.272
Instability index39.54
Isoelectric point5.33
Molecular weight56687.74
Publications
PubMed=12815422
PubMed=15489334
PubMed=30341416

Function

Annotated function F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of corepressor complexes that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of transcription repressor complexes, thereby allowing cofactor exchange (By similarity). 
ECO:0000250
GO - Cellular Component
histone deacetylase complex	GO:0000118	IBA:GO_Central
nucleoplasm	GO:0005654	IDA:HPA
nucleus	GO:0005634	IDA:UniProtKB
GO - Biological Function
transcription corepressor activity	GO:0003714	IBA:GO_Central
GO - Biological Process
histone deacetylation	GO:0016575	IBA:GO_Central
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP32835
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             8|     354.02|      39|      39|     333|     371|       1
---------------------------------------------------------------------------
  169-  208 (38.74/16.41)	...PNKatVLRGHESE...........VFICAWNPVS.........dllASGS.GDSTA.RI.WNL.
  229-  266 (37.22/15.53)	.GHDVP..S....NKD...........VTSLDWNSDG.........tllAMGS.YDGFA.RIwTENG
  267-  295 (29.75/11.18)	..NLAS..TLGQHKGP...........IFALKWNKKG......................nYV.LSAG
  296-  347 (41.22/17.85)	VDKTTI..IWDAHTGEakqqfpfhsapALDVDWQ..........nnmtfASCS.TDMCI.HV.CRLG
  348-  389 (64.24/31.22)	CDHPVK..TFQGHTNE...........VNAIKWDPSG.........mllASCS.DDMTL.KI.WSMK
  390-  440 (54.03/25.29)	QDACVH..DLQAHSKE...........IYTIKWSPTGpatsnpnssimlASAS.FDSTV.RL.WDVE
  444-  482 (55.20/25.97)	CTH.....TLMKHQEP...........VYSVAFSPDG.........kylASGS.FDKYV.HI.WNTQ
  483-  519 (33.62/13.43)	SGSLVH..SYQG.TGG...........IFEVCWNARG........dkvgASASdGSVCV........
---------------------------------------------------------------------------











Associated diseases
Disease
papillary thyroid cancer	PMID:32532820



























Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32835 with Med16 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KAATMTPAAISQQNPPKNREATVNGEENGAHEINNHSKPMEIDGDVEIPPNKA
120
172










Molecular Recognition Features






MoRF SequenceStartStop




NANANA