<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32828

Description Uncharacterized protein
SequenceMAPLEEGERAASSFFLPPPPRWEERSTMVHGRHGSRRVGAPPRVGSLTTIMISEPEQLNELQKVAVRFEEKIYTQATNQSDYLRRIPLKLHPLETQTQLAPGNAQVIPNQNNSGKIKTILLQAVSPRPYNTTLRYLKEITDNFSDKRILGHGGFGVVYKGVQRNGEMIAVKKIMSSLNQACRISSRARMLALLLVTNVDESSGLDWSTRYNIIEGICYGLCHLHEEIDKPIIHLDLKPANILLDDGMTAKIADFGLSRLLYQEQTICTKSRDGTFGYMAPEFILGGKITPKSDIFSLGVIILEVVTGHRDYPDVTITPSDDFIKLMLKKWRNVLQRSPRYLFLETVCEQIRRCIQVKSELGVEKNKQECSVNITIKPLSF
Length380
PositionTail
OrganismTriticum urartu (Red wild einkorn) (Crithodium urartu)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
Aromaticity0.07
Grand average of hydropathy-0.272
Instability index48.63
Isoelectric point9.04
Molecular weight42908.16
Publications
PubMed=23535596

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP32828
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.31|      19|      19|     269|     287|       2
---------------------------------------------------------------------------
  269-  287 (34.26/19.22)	KSRDGTFGYMAPEFILGGK
  291-  309 (31.05/16.91)	KSDIFSLGVIILEVVTGHR
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP32828 with Med15 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) GERAASSFFLPPPPRWEERSTMVHGRHGSRRVGAPPRVGSLTTIMI
7
52

Molecular Recognition Features

MoRF SequenceStartStop
NANANA