<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32827
| Description |
Uncharacterized protein |
| Sequence | ELQAVDRSLQSSHQIDVERHARDFMEAAKKLQSCFIDMQREDQPTNEELLRKEITTMEEELKTKSELIAKHKSLIEGWQKELKDQLGKHNTELERV |
| Length | 96 |
| Position | Head |
| Organism | Triticum urartu (Red wild einkorn) (Crithodium urartu) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.033 |
| Instability index | 64.33 |
| Isoelectric point | 5.39 |
| Molecular weight | 11345.68 |
| Publications | PubMed=23535596
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32827
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.57| 10| 19| 9| 26| 1
---------------------------------------------------------------------------
9- 19 (14.01/22.99) LQSSHqIDVER
31- 40 (20.56/ 6.08) LQSCF.IDMQR
---------------------------------------------------------------------------
|