<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32826
Description |
Uncharacterized protein |
Sequence | SGPRELTGAVDLISQYKLQPHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMKLDQLVQNAYLRDKPAYIKSFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDKDREHKKHKHRHKDRSKDKDKDKDKKKDKHHEKKRKHEGTEDSADVHKHKKSKHKSSKTDEMGNGLS |
Length | 194 |
Position | Head |
Organism | Triticum urartu (Red wild einkorn) (Crithodium urartu) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Triticum.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -1.545 |
Instability index | 33.85 |
Isoelectric point | 9.60 |
Molecular weight | 22404.07 |
Publications | PubMed=23535596
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32826
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.25| 17| 17| 120| 136| 1
---------------------------------------------------------------------------
126- 145 (24.42/ 7.61) KDKDREH.KKHKhrHKdRSKD
152- 169 (25.83/ 8.46) KKKDKHHeKKRK..HE.GTED
---------------------------------------------------------------------------
|