<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32818
| Description |
Uncharacterized protein |
| Sequence | MPVNEANNEREQINPAGAGNVGSRNELTANRNILTNSNTSQTSANPSSSLDEEVIRRRGKRERKYNIVTRSMDPRVLATRKSPVKRPRSNSATLDIIKMFAELQKSPAKTPVKRQRTSPPSSPGVMTRKRLNMSCDSGIGSASSSPSSTSGTRSSISKKAISVIKARRSRRNLRRSAAPGGEPKYDNIARVKTLVWSLKQSVQGLIKISAAYISHNAAVDSGLKAPDDKVLPAFDKAFEDFHSLLNQIELHFKTIQECAIQQRQSQKYLPGPDKYKAGPPKTEPYMDSGSDHELPYNQYIHLIRGQLSFVESLQKILLDGSRKIELHQTI |
| Length | 330 |
| Position | Tail |
| Organism | Tetranychus urticae (Two-spotted spider mite) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Acariformes> Trombidiformes> Prostigmata> Eleutherengona> Raphignathae>
Tetranychoidea> Tetranychidae> Tetranychus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.735 |
| Instability index | 76.57 |
| Isoelectric point | 10.19 |
| Molecular weight | 36589.09 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32818
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.36| 9| 24| 118| 128| 3
---------------------------------------------------------------------------
118- 128 (14.65/12.69) SPPSSPGvmTR
145- 153 (17.71/ 8.10) SPSSTSG..TR
---------------------------------------------------------------------------
|