<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32817
Description |
Uncharacterized protein |
Sequence | MTDQPSGSAAPGGEPKYDNIARVKTLVWSLKQSVQGLIKISAAYISHNAAVDSGLKAPDDKVLPAFDKAFEDFHSLLNQIELHFKTIQECAIQQRQSQKYLPGPDKYKAGPPKTEPYMDSDQTMNYPITNIFI |
Length | 133 |
Position | Tail |
Organism | Tetranychus urticae (Two-spotted spider mite) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Acariformes> Trombidiformes> Prostigmata> Eleutherengona> Raphignathae>
Tetranychoidea> Tetranychidae> Tetranychus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.509 |
Instability index | 54.69 |
Isoelectric point | 6.27 |
Molecular weight | 14769.58 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP32817
No repeats found
No repeats found
|