<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32813
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MTVNQYIKDVILGLINEIEQLSKSLIENMINNKRLRPNSGHTVNLTELGDSLVAKNAQLKKSIKLAMEMEEMAKKVDLLNLDISRADEEIKHLTKSFKEAEHILATAIYQAKQKLALIRQANAHPVPSEELIKYAYKISSCHSVAAPYNWEQGDLRRPYPTDIEMRSGFIGQMGGFVTSMATTGQQQQSSYNAQAAPNSSQQPMVEDHVFTKGFLESVHSSIDSKATISKDNIEDVEVMSTDSSSSSSSDSQ |
| Length | 252 |
| Position | Middle |
| Organism | Tetranychus urticae (Two-spotted spider mite) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Acariformes> Trombidiformes> Prostigmata> Eleutherengona> Raphignathae>
Tetranychoidea> Tetranychidae> Tetranychus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.466 |
| Instability index | 64.98 |
| Isoelectric point | 5.68 |
| Molecular weight | 27966.25 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32813
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 95.91| 27| 48| 156| 182| 2
---------------------------------------------------------------------------
156- 182 (49.42/37.57) RRPYPTDIEMRSGFIGQMGGFVTSMAT
201- 227 (46.49/34.95) QQPMVEDHVFTKGFLESVHSSIDSKAT
---------------------------------------------------------------------------
|