<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32808
| Description |
Uncharacterized protein |
| Sequence | MEKQFHLVTQLNRYQNELKIRISHDSEELNKVLILTLARAIHVTGCDTLIEWCKELLSNIMNSTPLAWSSCTLKCFPPAITEYYQNFNTVTKNKAQLKQSVEEEYRKWITMSNENDNSNSAHFLTFRILNVLFMNTGIFKSFKFIDVNIRLMLRVSIMYLYWNEYFSASFLSLFYSTNTS |
| Length | 180 |
| Position | Tail |
| Organism | Tetranychus urticae (Two-spotted spider mite) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Acariformes> Trombidiformes> Prostigmata> Eleutherengona> Raphignathae>
Tetranychoidea> Tetranychidae> Tetranychus.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.151 |
| Instability index | 38.67 |
| Isoelectric point | 8.31 |
| Molecular weight | 21243.23 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32808
No repeats found
No repeats found
|