Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MITEVVRRTNGEQYSPKSSPRGSRSPLVTNSRQDTTGTLKTTISLGKTPTIVHSGPFYLMKEPGGESELTGATNLIKHYNLEHSYNKFCCGRKIKDQLSAFLPNLPGNIDVPATPNDSLRSLMEKPPIGGKEIIPLAQNQLSGFRLHPGPLPEQFRLMHQPIIKKKHKSKKSKNKSEETSNHESQIEIAETSATGGHEKKHKNKRKHEDDKERKKKKKDKKKKKAKHSPESVNA |
Length | 234 |
Position | Head |
Organism | Tetranychus urticae (Two-spotted spider mite) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari> Acariformes> Trombidiformes> Prostigmata> Eleutherengona> Raphignathae> Tetranychoidea> Tetranychidae> Tetranychus. |
Aromaticity | 0.04 |
Grand average of hydropathy | -1.120 |
Instability index | 54.54 |
Isoelectric point | 9.94 |
Molecular weight | 26240.68 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32805 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 81.66| 18| 49| 164| 181| 1 --------------------------------------------------------------------------- 164- 181 (31.16/14.71) KKKHKSKKSK..NKSEETSN 198- 212 (25.32/10.70) EKKHKNKR.....KHEDDKE 214- 233 (25.18/10.60) KKKKKDKKKKkaKHSPESVN --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 46.39| 16| 33| 112| 128| 2 --------------------------------------------------------------------------- 112- 128 (25.80/22.94) PATPN.............DSLRsLMEKPPI 135- 163 (20.59/12.53) PLAQNqlsgfrlhpgplpEQFR.LMHQPII --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GGHEKKHKNKRKHEDDKERKKKKKDKKKKKAKHSPESVNA 2) QIEIAETSA | 195 185 | 234 193 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab