<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32805
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MITEVVRRTNGEQYSPKSSPRGSRSPLVTNSRQDTTGTLKTTISLGKTPTIVHSGPFYLMKEPGGESELTGATNLIKHYNLEHSYNKFCCGRKIKDQLSAFLPNLPGNIDVPATPNDSLRSLMEKPPIGGKEIIPLAQNQLSGFRLHPGPLPEQFRLMHQPIIKKKHKSKKSKNKSEETSNHESQIEIAETSATGGHEKKHKNKRKHEDDKERKKKKKDKKKKKAKHSPESVNA |
| Length | 234 |
| Position | Head |
| Organism | Tetranychus urticae (Two-spotted spider mite) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Acariformes> Trombidiformes> Prostigmata> Eleutherengona> Raphignathae>
Tetranychoidea> Tetranychidae> Tetranychus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.120 |
| Instability index | 54.54 |
| Isoelectric point | 9.94 |
| Molecular weight | 26240.68 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32805
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 81.66| 18| 49| 164| 181| 1
---------------------------------------------------------------------------
164- 181 (31.16/14.71) KKKHKSKKSK..NKSEETSN
198- 212 (25.32/10.70) EKKHKNKR.....KHEDDKE
214- 233 (25.18/10.60) KKKKKDKKKKkaKHSPESVN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.39| 16| 33| 112| 128| 2
---------------------------------------------------------------------------
112- 128 (25.80/22.94) PATPN.............DSLRsLMEKPPI
135- 163 (20.59/12.53) PLAQNqlsgfrlhpgplpEQFR.LMHQPII
---------------------------------------------------------------------------
|