<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32798

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMVQHRPQQAQQIQLQQQQQPPTQQSLPPPPPPQQSQQPLPPQMQQQPQPQQQQQQQHFQQGPQMQQGHLIINQGGPQQINQMHPHSHNQSNQMNQMNVTMSPAAQFVPSPSQNIMPSPMSVGMMQSRGGPGSIPSVPSPGPLNTPQMASQVSPAQRQMTDDQAYQEKLKQLSRYIEPLRARLEREESGSDKKKEYSKLRNLFNIISDSSVRVPMELLLKCEIILEKMEFANQTQMAINQHQQTHMNQQNLSKMPDQNIGQPLMDALINNIKKPFFNHTLHRTFSRAVCSLSNGTQWNSNPIPRKKPLTSPTEIPEVIQGEVARLDPKFKVQLHPLHQPGSQTIHLICRLDDQDLPCVPPISLEVPDDYPNEPPQCFIDSEEYSASPILMNIRRMFTDHIGNLPNIYSIMTLLNRWEMSVRQACNNPPIVAA
Length431
PositionTail
OrganismTetranychus urticae (Two-spotted spider mite)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari> Acariformes> Trombidiformes> Prostigmata> Eleutherengona> Raphignathae> Tetranychoidea> Tetranychidae> Tetranychus.
Aromaticity0.04
Grand average of hydropathy-0.789
Instability index78.09
Isoelectric point7.73
Molecular weight48953.22
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364148

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32798
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     118.80|      24|      27|       6|      32|       1
---------------------------------------------------------------------------
    6-   29 (48.16/11.27)	PQQAQQIQLQQQQQP...................PTQQS.LPPP
   49-   72 (36.94/ 6.37)	PQQQQQ.QQHFQQGP...................QMQQGhLIIN
   76-  118 (33.70/ 9.26)	PQQINQMHPHSHNQSnqmnqmnvtmspaaqfvpsPSQNI.MPSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     156.22|      44|      58|     277|     320|       3
---------------------------------------------------------------------------
  277-  320 (80.77/38.28)	HTLHRTFSRA...VCSLSNGTQWNSNPIPRKKPLTSPTEIPE.VIQGE
  333-  380 (75.45/35.31)	HPLHQPGSQTihlICRLDDQDLPCVPPISLEVPDDYPNEPPQcFIDSE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.05|      14|      26|      96|     109|       5
---------------------------------------------------------------------------
   96-  109 (27.15/15.40)	MNVTM.....SPAA.QFVPS
  119-  138 (17.90/ 7.69)	MSVGMmqsrgGPGSiPSVPS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32798 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MVQHRPQQAQQIQLQQQQQPPTQQSLPPPPPPQQSQQPLPPQMQQQPQPQQQQQQQHFQQGPQMQQGHLIINQGGPQQINQMHPHSHNQSNQMNQMNVTMSPAAQFVPSPSQNIMPSPMSVGMMQSRGGPGSIPSVPSPGPLNTPQMASQVSPAQRQMTDDQAYQEKLKQ
1
170










Molecular Recognition Features






MoRF SequenceStartStop




NANANA