<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32798
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MVQHRPQQAQQIQLQQQQQPPTQQSLPPPPPPQQSQQPLPPQMQQQPQPQQQQQQQHFQQGPQMQQGHLIINQGGPQQINQMHPHSHNQSNQMNQMNVTMSPAAQFVPSPSQNIMPSPMSVGMMQSRGGPGSIPSVPSPGPLNTPQMASQVSPAQRQMTDDQAYQEKLKQLSRYIEPLRARLEREESGSDKKKEYSKLRNLFNIISDSSVRVPMELLLKCEIILEKMEFANQTQMAINQHQQTHMNQQNLSKMPDQNIGQPLMDALINNIKKPFFNHTLHRTFSRAVCSLSNGTQWNSNPIPRKKPLTSPTEIPEVIQGEVARLDPKFKVQLHPLHQPGSQTIHLICRLDDQDLPCVPPISLEVPDDYPNEPPQCFIDSEEYSASPILMNIRRMFTDHIGNLPNIYSIMTLLNRWEMSVRQACNNPPIVAA |
| Length | 431 |
| Position | Tail |
| Organism | Tetranychus urticae (Two-spotted spider mite) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Acariformes> Trombidiformes> Prostigmata> Eleutherengona> Raphignathae>
Tetranychoidea> Tetranychidae> Tetranychus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.789 |
| Instability index | 78.09 |
| Isoelectric point | 7.73 |
| Molecular weight | 48953.22 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32798
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 118.80| 24| 27| 6| 32| 1
---------------------------------------------------------------------------
6- 29 (48.16/11.27) PQQAQQIQLQQQQQP...................PTQQS.LPPP
49- 72 (36.94/ 6.37) PQQQQQ.QQHFQQGP...................QMQQGhLIIN
76- 118 (33.70/ 9.26) PQQINQMHPHSHNQSnqmnqmnvtmspaaqfvpsPSQNI.MPSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 156.22| 44| 58| 277| 320| 3
---------------------------------------------------------------------------
277- 320 (80.77/38.28) HTLHRTFSRA...VCSLSNGTQWNSNPIPRKKPLTSPTEIPE.VIQGE
333- 380 (75.45/35.31) HPLHQPGSQTihlICRLDDQDLPCVPPISLEVPDDYPNEPPQcFIDSE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.05| 14| 26| 96| 109| 5
---------------------------------------------------------------------------
96- 109 (27.15/15.40) MNVTM.....SPAA.QFVPS
119- 138 (17.90/ 7.69) MSVGMmqsrgGPGSiPSVPS
---------------------------------------------------------------------------
|