| Description | Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MTSNPKLIPQQEYILQGSINDSAVEMLLHRLQGLCDNADDPTETFLDREYIYSIKNPSGQAVMLRVRQDLERKDYPWHLRYLGQPEIGDKTRATLVRSCIDVACSNNVCKFLTEMGFKKDYEFYSKGYMFKKGRLKVIVAKIFHVPTSEVGQQQPVFADSNVQTVTQSYLVEVSIVAPSGSDPLADEIKQFADQLKPLVNLEKIDPRRLA |
| Length | 210 |
| Position | Head |
| Organism | Tetranychus urticae (Two-spotted spider mite) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari> Acariformes> Trombidiformes> Prostigmata> Eleutherengona> Raphignathae> Tetranychoidea> Tetranychidae> Tetranychus. |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.378 |
| Instability index | 41.73 |
| Isoelectric point | 6.32 |
| Molecular weight | 23906.12 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP32793
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.53| 21| 34| 10| 32| 1
---------------------------------------------------------------------------
10- 32 (30.18/25.10) QQEYILqgSINDSAVEMLLHRLQ
47- 67 (36.35/23.00) DREYIY..SIKNPSGQAVMLRVR
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) TFLDREYIY 2) YPWHLRYL | 44 75 | 52 82 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab