Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MAETLRRSEQYSPKSSPRGARSPVVPRQDSTGTLKTTISLGKNPAIVHSGPFYLMKEPPTQSELTGATNLMNYYGLEHSYNKFTGKKVKDQLSAFLPNLPGMIDMPGHQDNSSLRSLIEKPPIGGKELIPLSGSQLLGFRLHTGPLPEHYRIMNQIPQKKKHKHKKHKLKPGDTPSHEPPGENSQETHEKKHKKQKRHDDDKERKKKKKEKKKKKVQHEGPLLPKLNL |
Length | 228 |
Position | Head |
Organism | Strigamia maritima (European centipede) (Geophilus maritimus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Myriapoda> Chilopoda> Pleurostigmophora> Geophilomorpha> Linotaeniidae> Strigamia. |
Aromaticity | 0.04 |
Grand average of hydropathy | -1.192 |
Instability index | 54.91 |
Isoelectric point | 10.02 |
Molecular weight | 25840.47 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32773 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 84.88| 18| 45| 158| 175| 1 --------------------------------------------------------------------------- 158- 175 (32.80/13.21) QK..........KKHKHKKHKLKPGDTP 176- 203 (22.49/ 7.13) SHeppgensqetHEKKHKKQKRHDDDKE 204- 221 (29.59/11.32) RK..........KKKKEKKKKKVQHEGP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KKHKHKKHKLK 2) QETHEKKHKKQKRHDDDKERKKKKKEKKKKKVQHEGPL | 160 185 | 170 222 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab