<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32765
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MKRVNFPETEEQQRLRFQIELEFVQCLANPNYLNFLAQRGYFKDQSFINYLKYLQYWKEPTYAKYLKYPMCLHFLELLQYEHFRKEIVSGQCAKFIDDQQILHWQHYTRKRMKLLQTQAEQNPGK |
| Length | 125 |
| Position | Middle |
| Organism | Strigamia maritima (European centipede) (Geophilus maritimus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Myriapoda> Chilopoda>
Pleurostigmophora> Geophilomorpha> Linotaeniidae> Strigamia.
|
| Aromaticity | 0.17 |
| Grand average of hydropathy | -0.761 |
| Instability index | 41.83 |
| Isoelectric point | 9.10 |
| Molecular weight | 15495.69 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32765
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.06| 16| 24| 64| 85| 1
---------------------------------------------------------------------------
64- 85 (23.23/21.87) KylkypmCLHFLE...LLQYEHF.RK
91- 110 (22.82/ 9.22) Q......CAKFIDdqqILHWQHYtRK
---------------------------------------------------------------------------
|