<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32764
Description |
Uncharacterized protein |
Sequence | MAGNFWHSSHYQQWLLDKQDLIRERQVDMAVLTEEEYQKIIIFFANLIQTLGEQLKVRQQVIATATTYFKRFYARNSLKCIDPFLLAPTCIFLASKVEEFGMISNSRLISTCQTVIKTKFNYAHSQEYPYRIQNVVECEFFLLEMMDCCLVIYLPYRPLIQYAQDLGHEDTILPLAWRIVNDSLRTDVCLLYPPYLISLACLHMACVIQQKDVKQWFAELNVDMEKILEITRYILALYELWKGFDERKEIQALLAKMPKAKTQPPGLNTGGPQNNVDPNNPQSSNGSNQTTQSTVGVQ |
Length | 298 |
Position | Kinase |
Organism | Strigamia maritima (European centipede) (Geophilus maritimus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Myriapoda> Chilopoda>
Pleurostigmophora> Geophilomorpha> Linotaeniidae> Strigamia.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.146 |
Instability index | 46.75 |
Isoelectric point | 6.00 |
Molecular weight | 34511.54 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32764
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.44| 14| 37| 147| 163| 1
---------------------------------------------------------------------------
147- 163 (21.54/22.79) DCCLvIYLPYrpLIQYA
187- 200 (28.90/16.60) DVCL.LYPPY..LISLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.08| 13| 23| 11| 23| 4
---------------------------------------------------------------------------
11- 23 (23.85/12.70) YQQWLLDKQDLIR
37- 49 (22.23/11.46) YQKIIIFFANLIQ
---------------------------------------------------------------------------
|