<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32759

Description Uncharacterized protein
SequenceMSAVEVSKIAKTLDKMVKSDGSGQDQALDLLKTLKDLSITYDVLQKTRIGKSVNALRKSSKDDEVINLAKKLIKSWKKCLPGDSLSSSSTKKPISKTVSLPAAKKVIPVKVSNLQPVVSISAASHDHHTANAVRTKCREMLSVALKWTAMPDGSADPDELAVLIEDCVFKEFKNTDAKYKNCIRSRVSNLKDPKNPGLRENVLLGRISVEKIAVMTTLEMASAEMKKLRERMIKKANNIRKVPIPQAASYGLIKCKKCKSGNCSYTQAQTRSADEPMTTFAFYGCEVQNRIRSRVSNLKDSKNPCLRENVLLGQISPEQIAVMTTLEMASADLKLLRKEISKESIKRHRLPEPVKPSSSHDLVKCKKCKGNNCSYTQAQVGMRLGCTSESMTTFAHCHDCGIRWTSDTESELILSYHIGLIL
Length422
PositionUnknown
OrganismStrigamia maritima (European centipede) (Geophilus maritimus)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Myriapoda> Chilopoda> Pleurostigmophora> Geophilomorpha> Linotaeniidae> Strigamia.
Aromaticity0.04
Grand average of hydropathy-0.381
Instability index36.80
Isoelectric point9.53
Molecular weight46715.95
Publications

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
nucleic acid binding	GO:0003676	IEA:InterPro
zinc ion binding	GO:0008270	IEA:InterPro
GO - Biological Process
transcription, DNA-templated	GO:0006351	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP32759
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     342.99|      90|     107|     180|     269|       1
---------------------------------------------------------------------------
  180-  269 (173.49/94.99)	KNCIRSRVSNLKDPKNPGLRENVLLGRISVEKIAVMTTLEMASAEMKKLRERMIKKANNIRKVPIP..QAASYGLIKCKKCKSGNCSYTQAQ
  288-  379 (169.50/92.66)	QNRIRSRVSNLKDSKNPCLRENVLLGQISPEQIAVMTTLEMASADLKLLRKEISKESIKRHRLPEPvkPSSSHDLVKCKKCKGNNCSYTQAQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.48|      13|     112|     275|     287|       2
---------------------------------------------------------------------------
  275-  287 (27.49/23.30)	EPMTTFAF.YGCEV
  389-  402 (22.99/18.29)	ESMTTFAHcHDCGI
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP32759 with Med26 domain of Kingdom Metazoa

Unable to open file!