| Description | Uncharacterized protein |
| Sequence | MARHMECFFLQKRLLLSAQKPEQILREDINELKLELTRKEQLIQKHYEKIQYWQGLLSDLQGPGRPPQPPPPLTAQLSGPPQPPMVQQQVPNMSTQVMRSAMPSMQPPQMYGHQPPPGNPHMVPSQMGQQNPTGMMQSPLAYLEKTTSNIGMNDLRR |
| Length | 157 |
| Position | Head |
| Organism | Strigamia maritima (European centipede) (Geophilus maritimus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Myriapoda> Chilopoda> Pleurostigmophora> Geophilomorpha> Linotaeniidae> Strigamia. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.795 |
| Instability index | 75.60 |
| Isoelectric point | 9.41 |
| Molecular weight | 17915.65 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP32756
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.81| 18| 22| 71| 91| 1
---------------------------------------------------------------------------
71- 91 (35.10/21.92) PPltaQLSG....PPQPPMVQ....QQVP
107- 132 (30.71/12.61) PP...QMYGhqppPGNPHMVPsqmgQQNP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.25| 21| 40| 3| 23| 2
---------------------------------------------------------------------------
3- 23 (37.22/23.43) RHMECFFLQKRLLLSAQKPEQ
45- 65 (39.04/24.88) KHYEKIQYWQGLLSDLQGPGR
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) YWQGLLSDLQGPG | 52 | 64 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab