<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32750
Description |
Uncharacterized protein |
Sequence | MATTTNGNGNLVDEFEEAFQSCLSVLTKEEALATMEKEEMRAEVDHSVLRFIDLARQMEAFFLQKRFLLSALKPELVVREDINDLKSELARKEDLLKRHHEKITLWQNLLADVQGWAKSQAQGPATPSGMNGVPPSGTPPQPAM |
Length | 144 |
Position | Head |
Organism | Rhodnius prolixus (Triatomid bug) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Heteroptera> Panheteroptera>
Cimicomorpha> Reduviidae> Triatominae> Rhodnius.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.418 |
Instability index | 43.06 |
Isoelectric point | 5.10 |
Molecular weight | 16120.21 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP32750
No repeats found
No repeats found
|