<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32748
| Description |
Uncharacterized protein (Fragment) |
| Sequence | SVHFFDCQIFSIKSVEVNMMNMQTMQPGQVMGQVMPPQQQVNPMVVNPQGQPNITGLQPQSQEKLDNISKVKTLVGPLRDSLAATLKTAARTLHQNSLVDIGSLKNADDSPPQFDKSMEEFYSICDQIELHLKTSIECLNQGASSQRYLNMTVTPQRSEPVPGQQEMNTLTYPQYLATVRTQVSFAKELHDMLLAAAQNVTSA |
| Length | 203 |
| Position | Tail |
| Organism | Rhodnius prolixus (Triatomid bug) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Heteroptera> Panheteroptera>
Cimicomorpha> Reduviidae> Triatominae> Rhodnius.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.370 |
| Instability index | 49.99 |
| Isoelectric point | 5.51 |
| Molecular weight | 22524.44 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32748
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.39| 19| 22| 17| 38| 2
---------------------------------------------------------------------------
17- 38 (29.98/21.18) VNMMNMQTM.QPgQVMGqvMPPQ
41- 60 (32.41/13.84) VNPMVVNPQgQP.NITG..LQPQ
---------------------------------------------------------------------------
|