<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32729
| Description |
Uncharacterized protein |
| Sequence | XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEIPNSTHNQFNWNQMGEIHMGMGSSSVPLDTRHKDTSQDDVEVMSTDSSSSSSSDSQ |
| Length | 154 |
| Position | Middle |
| Organism | Megaselia scalaris (Humpbacked fly) (Phora scalaris) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Platypezoidea>
Phoridae> Megaseliini> Megaselia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.070 |
| Instability index | 74.72 |
| Isoelectric point | 4.30 |
| Molecular weight | 6244.50 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32729
No repeats found
No repeats found
|