<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32723
Description |
Uncharacterized protein |
Sequence | TDLCGIKWRKFFGNERPNTSLDPLEDPILRSYSRCLDMNILCVWRRVESPRQEPDPNSTGGIFDSITNTTTVHPPLSLTAAKELWIFWYGEEPELSGAVDSQLLKQGAREAMISRSPSEAIMKGTQFGLSGVLRFCGESNGAFALHTTGNSQ |
Length | 152 |
Position | Middle |
Organism | Megaselia scalaris (Humpbacked fly) (Phora scalaris) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Platypezoidea>
Phoridae> Megaseliini> Megaselia.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.390 |
Instability index | 48.00 |
Isoelectric point | 5.39 |
Molecular weight | 16865.83 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP32723
No repeats found
No repeats found
|