Description | Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGVTILQPYMSPEGKGGILAVEHLTKRLLSLGAKQAGSFIVDCDTIISLTPSMAQPSVNKAVHILHNSEFPASTFAILDTGAKHIPLVADNLFDLLMIKIGNVYTQKKQPNIESKGPRFEYGDFLIKLGSNNSRQNSLDELCMKEEALKQRDEMVSCLLEELVKVRQSLAESEDTIRTLKTKVEELEEDKKTLREITPDNSVAHLQDELIASKLREAEASLSLKDLKQRVQELSTQWQRQLQEPKKSESLPVDSTPKKLLSTIWDTSKGSNEQLQKLEEELMTTRIREMETLTELKELRLKVMELETQVQVSTNQLRRQDEESKKLKEELEMSLNREKESANRTREQQHRYSDLESRMKDELMNVKIKFTEQSQTVAELKQEISRLETK |
Length | 389 |
Position | Head |
Organism | Megaselia scalaris (Humpbacked fly) (Phora scalaris) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Platypezoidea> Phoridae> Megaseliini> Megaselia. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.674 |
Instability index | 54.12 |
Isoelectric point | 5.59 |
Molecular weight | 44565.41 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32722 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 5| 243.81| 46| 46| 148| 193| 1 --------------------------------------------------------------------------- 148- 191 (57.30/31.09) ...........................LKQR.....DEMVSCLLEELVKVRQSLAESEDTIRTLKTKVEELEED.KK 192- 239 (49.40/25.82) TL.............................reitpDNSVAHLQDELIASKLREAEASLSLKDLKQRVQELSTQwQR 240- 310 (52.56/27.93) QLqepkkseslpvdstpkkllstiwdtSKGS.....NEQLQKLEEELMTTRIREMETLTELKELRLKVMELETQ.VQ 313- 359 (61.69/34.02) TN........................qLRRQ.....DEESKKLKEELEMSLNREKESANRTREQQHRYSDLESR.MK 361- 387 (22.86/ 8.10) .............................................ELMNVKIKFTEQSQTVAELKQEISRLE..... --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FEYGDFLI 2) LLSTIW | 119 259 | 126 264 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab