<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32720

Description Uncharacterized protein
SequenceMASSTNGNGNLMDEFEEAFQACLHALTKKETNTGVTKDEIELEVHETTNKFIDIAHQMEVFFLQKRFLLSTKPEMLLHEENTDLKNEIVRKEGLIKKHYNNLDEWKKLLNQQQSHHSSQQMQMQQQQQIPGGEMWQGGAGGMNKPPGIPPNMMSPQMAGVGGMPINPMHQQNPQHYQQMQQQQMLHAQQQQQMFQMQQQQNFIGPNRSPASGFVGQPNSNRMPSPLTYLEKTTSNIDMGNMGDRSLSILVCI
Length252
PositionHead
OrganismMegaselia scalaris (Humpbacked fly) (Phora scalaris)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Platypezoidea> Phoridae> Megaseliini> Megaselia.
Aromaticity0.06
Grand average of hydropathy-0.817
Instability index59.42
Isoelectric point6.05
Molecular weight28691.25
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32720
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.78|      15|      15|     168|     182|       1
---------------------------------------------------------------------------
  168-  182 (33.53/14.06)	M.HQQNPQHYQQMQQQ
  184-  199 (25.25/ 8.88)	MlHAQQQQQMFQMQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.00|      15|      18|     129|     146|       2
---------------------------------------------------------------------------
  129-  146 (28.24/20.40)	IPGGEM..WQGGAGGMnkpP
  148-  164 (27.76/12.41)	IPPNMMspQMAGVGGM...P
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32720 with Med28 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) WKKLLNQQQSHHSSQQMQMQQQQQIPGGEMWQGGAGGMNKPPGIPPNMMSPQMAGVGGMPINPMHQQNPQHYQQMQQQQMLHAQQQQQMFQMQQQQNFIGPNRSPASGFVGQPNSNRMPSPLTYLEKTTSNIDMGN
105
240










Molecular Recognition Features






MoRF SequenceStartStop




NANANA