<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32720
| Description |
Uncharacterized protein |
| Sequence | MASSTNGNGNLMDEFEEAFQACLHALTKKETNTGVTKDEIELEVHETTNKFIDIAHQMEVFFLQKRFLLSTKPEMLLHEENTDLKNEIVRKEGLIKKHYNNLDEWKKLLNQQQSHHSSQQMQMQQQQQIPGGEMWQGGAGGMNKPPGIPPNMMSPQMAGVGGMPINPMHQQNPQHYQQMQQQQMLHAQQQQQMFQMQQQQNFIGPNRSPASGFVGQPNSNRMPSPLTYLEKTTSNIDMGNMGDRSLSILVCI |
| Length | 252 |
| Position | Head |
| Organism | Megaselia scalaris (Humpbacked fly) (Phora scalaris) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Platypezoidea>
Phoridae> Megaseliini> Megaselia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.817 |
| Instability index | 59.42 |
| Isoelectric point | 6.05 |
| Molecular weight | 28691.25 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32720
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.78| 15| 15| 168| 182| 1
---------------------------------------------------------------------------
168- 182 (33.53/14.06) M.HQQNPQHYQQMQQQ
184- 199 (25.25/ 8.88) MlHAQQQQQMFQMQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.00| 15| 18| 129| 146| 2
---------------------------------------------------------------------------
129- 146 (28.24/20.40) IPGGEM..WQGGAGGMnkpP
148- 164 (27.76/12.41) IPPNMMspQMAGVGGM...P
---------------------------------------------------------------------------
|