Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MQREEKQWEMTLEQILSRLNDLKLSIGNMIQVLETQYETINWPTFLDNFALISSHLTGISKILNRRDMGGCLLRNRTFLPLTLSQDRDEHLVQIMKDVTKPDPTAEARMIAHEQKANSLNADTANKQVMQFNKVVGHISDIISEHRDKFETESSARAGIQQTSSMTDTQALVAAVGIGKGLLKMPMAPMGGGPGQVMLPPGGIRPPSMMSSLVWTKMVKKPKGLLVLEEMAAAERQLQEPFLRHGEHSNSNTTGSSEMVPNLDLTSNESYPSTDNELWYGKACEMSKMITKPDAFKAWLSAKKKSEFYESMRKKALEEELEKTKAEKKRIADEKYKEWLKKKSATSLVKKKSSTQLTSPKQTRSQEEIDHNFEQWLLKKAEYDRHLKERIREELEQKRILEDTKKKISEKIYNKWLETAPYKPKPVPMNKGLESLRGSTTEIHKNPEPWRTVIGEEVDDLSTCEEVPEMRF |
Length | 471 |
Position | Head |
Organism | Megaselia scalaris (Humpbacked fly) (Phora scalaris) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Platypezoidea> Phoridae> Megaseliini> Megaselia. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.744 |
Instability index | 46.73 |
Isoelectric point | 8.60 |
Molecular weight | 53908.28 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32715 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 4| 186.71| 37| 37| 302| 338| 1 --------------------------------------------------------------------------- 268- 298 (28.55/11.27) ....ESYPS.....TDNELWYGK...AcEmSKMIT.KpDAFKAW 302- 338 (60.86/30.95) KKKSEFYESMRKKALEEELEKTK...A.E.KKRIA.D.EKYKEW 340- 375 (47.39/22.74) KKKSA..TSLVKKKSSTQLTSPK...Q.T.RSQEEiD.HNFEQW 377- 415 (49.91/24.28) LKKAE.YDRHLKERIREELEQKRileD.T.KKKIS.E.KIYNKW --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 93.67| 29| 41| 158| 198| 2 --------------------------------------------------------------------------- 158- 187 (45.30/56.03) GIQqTSSMTDTQALVAAVGIGKGLLKM.PMA 202- 231 (48.37/26.25) GIR.PPSMMSSLVWTKMVKKPKGLLVLeEMA --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) QLQEPFLRHGEHSNSNTTGSSEMVPNLDLTSN | 236 | 267 |
MoRF Sequence | Start | Stop |
1) KIYNKWLE 2) YKEWLKKK | 410 335 | 417 342 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab