| Description | Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | METQTQDIKPIINETQPSQIQENTLKIADLDIEILPTIYEIIRCVEKDPSDNRNVSQECSQKILELKRRFDTARSQIKQLSGIDFNKEEQLQKRELLRSQLKQKQELIAKYKNKQF |
| Length | 116 |
| Position | Middle |
| Organism | Megaselia scalaris (Humpbacked fly) (Phora scalaris) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Platypezoidea> Phoridae> Megaseliini> Megaselia. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.927 |
| Instability index | 73.34 |
| Isoelectric point | 7.71 |
| Molecular weight | 13746.55 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP32713
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.13| 18| 23| 61| 79| 1
---------------------------------------------------------------------------
61- 79 (25.40/20.13) QKILELKRRfDTARSQIKQ
86- 103 (29.73/18.16) NKEEQLQKR.ELLRSQLKQ
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DIKPIINETQ 2) SQIQENTLKIADLDIEILPTIYEIIRCVEKDPSDNRNVSQECSQKILELKRRFDTARSQIKQLSGIDFNKEEQLQKRELLRSQLKQKQELIAKYKNKQF | 7 18 | 16 116 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab