<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32711
Description |
Mediator of RNA polymerase II transcription subunit 15 |
Sequence | MEWNDCMMAMPWLGKVRYLDSEKIAKINRLLEILLNPQQRIPLETLLKCEKALERMDILHIAPSNKHHFLETVNTVLQTPTGHHTLYRTFHPSFESLFGTDIQMSSIPKKRSMPVEESQETPHVLQGEIARLDQKFKVTLDPATQNQNKTLTLNCCLDDKCLPWVPPICVTIPENYPFISPTCTLNKQEYTATPFLSSVEKSLASRIGKLPKLHSLSHILDTWEMSVRQACSPTSSALTAEDALADILAF |
Length | 250 |
Position | Tail |
Organism | Megaselia scalaris (Humpbacked fly) (Phora scalaris) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Platypezoidea>
Phoridae> Megaseliini> Megaselia.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.242 |
Instability index | 56.05 |
Isoelectric point | 6.30 |
Molecular weight | 28382.58 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32711
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 174.53| 53| 149| 4| 81| 1
---------------------------------------------------------------------------
23- 75 (87.55/82.57) KIAKINRLLEILLNPQQRIPLETL.LKC...EKALERMDILHIAPSNKHHFLETVNT
128- 184 (86.98/38.00) EIARLDQKFKVTLDPATQNQNKTLtLNCcldDKCLPWVPPICVTIPENYPFISPTCT
---------------------------------------------------------------------------
|