Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MNTNEIFKIPGNALLELSKEKSSQKNAENHTQAFLKNLAQIEKQLSEQINYLSQVSTGHPHEGSSYASAKVLQMAWHRNSQTRERLMELEELRTKYSQVNAQRQQQQQQQMQQQQQNQ |
Length | 118 |
Position | Head |
Organism | Megaselia scalaris (Humpbacked fly) (Phora scalaris) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Platypezoidea> Phoridae> Megaseliini> Megaselia. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.203 |
Instability index | 50.36 |
Isoelectric point | 9.00 |
Molecular weight | 13768.13 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32707 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 94.74| 31| 71| 14| 48| 1 --------------------------------------------------------------------------- 14- 48 (44.59/24.46) LLELS..KEKSSQKNAENHTQaflkNLAQIEKQLSEQ 86- 118 (50.15/20.69) LMELEelRTKYSQVNAQRQQQ....QQQQMQQQQQNQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MNTNEIFKIPGNALLELSKEKSSQ 2) NAENHTQAFLKNLAQIEKQLSEQINYLSQVSTGHPHEGSSYASAKVLQMAWHRNSQTRERLMELEELRTKYSQVNAQRQQQQQ | 1 26 | 24 108 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab