<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32692
| Description |
Uncharacterized protein |
| Sequence | MADRLTQLQEAANLLADHFCNAVGILQQIAPPGQFAGFEKSASATKPAQVTSDETALLFAQLIARTAKDIDILVDSLPNEDSSPELQVASLRRLETENQIAARQLEQAISKGEFLLEQIQKSLHEIAQTQLHCQALEAEFR |
| Length | 141 |
| Position | Middle |
| Organism | Helobdella robusta (Californian leech) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Annelida> Clitellata>
Hirudinea> Rhynchobdellida> Glossiphoniidae> Helobdella.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.190 |
| Instability index | 39.98 |
| Isoelectric point | 4.69 |
| Molecular weight | 15481.28 |
| Publications | PubMed=23254933
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP32692
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.84| 15| 25| 99| 114| 1
---------------------------------------------------------------------------
99- 114 (21.82/17.05) QIAARQLE.QAIsKGEF
125- 140 (22.02/12.17) EIAQTQLHcQAL.EAEF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.40| 14| 28| 47| 62| 2
---------------------------------------------------------------------------
47- 62 (19.00/15.44) PAQVTSDEtaLLFAQL
78- 91 (24.40/13.46) PNEDSSPE..LQVASL
---------------------------------------------------------------------------
|