<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32686
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MQGREEKQLDASLEAIIQRIHDLRQSLISFICKLENEYNTLNWTTVLDNYALLSGQISLLGKFLKSDKMSHLKNYVAIPFSLSPELDPNLEKLTEGRVPYFNHEVVPNYLRTKPEPEIEDRLAQMQNKAHSLTAENLQKQTNTLNKLANLIQETLKNSKEMLDGDPVQKGMPLQTCTTADTTNLVAAMLTGKGLKPSSTSSMQQQQIGDVRSGSAGGGNSSVQQVMSNMTNMSKAPNPIKTNVKAAMISTQYNR |
| Length | 254 |
| Position | Head |
| Organism | Helobdella robusta (Californian leech) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Annelida> Clitellata>
Hirudinea> Rhynchobdellida> Glossiphoniidae> Helobdella.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.536 |
| Instability index | 40.87 |
| Isoelectric point | 8.42 |
| Molecular weight | 28225.86 |
| Publications | PubMed=23254933
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000978 IBA:GO_Central
transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP32686
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.19| 12| 17| 127| 142| 1
---------------------------------------------------------------------------
127- 138 (20.06/18.73) NKAHSLTAENLQ
145- 156 (19.13/ 6.09) NKLANLIQETLK
---------------------------------------------------------------------------
|