<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32683
| Description |
Uncharacterized protein |
| Sequence | MAEKPNLMEKFETAFHDCLTLMAEGAPSNTSADADPSELKLNVEVTFNKFNEAARLMENFFLEKQLILAADQDARENIEDLKSELERKECIIQRNRQKLQNWMSLANSSCGGSSHGEPSGAANSSSSLQTNQRL |
| Length | 134 |
| Position | Head |
| Organism | Helobdella robusta (Californian leech) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Annelida> Clitellata>
Hirudinea> Rhynchobdellida> Glossiphoniidae> Helobdella.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.643 |
| Instability index | 52.23 |
| Isoelectric point | 4.85 |
| Molecular weight | 14924.48 |
| Publications | PubMed=23254933
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32683
No repeats found
No repeats found
|