<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32681
| Description |
Uncharacterized protein |
| Sequence | MSKSQTTAKVLPPTKESQLKSYQKRLKDDVRSMYENFSEIFKLVKIDEDSVLGKPSQAEQDRYEIEVRAANMVRAAESLMRLVSEIKQFLILNDFAQVNEALKQNVDYYMRAQNKIDSHINIIREEMINELYDLEEEYYSSQYK |
| Length | 144 |
| Position | Head |
| Organism | Helobdella robusta (Californian leech) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Annelida> Clitellata>
Hirudinea> Rhynchobdellida> Glossiphoniidae> Helobdella.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.713 |
| Instability index | 60.92 |
| Isoelectric point | 5.18 |
| Molecular weight | 17016.09 |
| Publications | PubMed=23254933
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32681
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.12| 17| 27| 98| 115| 1
---------------------------------------------------------------------------
98- 115 (24.98/18.75) VNEALKQNVDYYmRAQNK
128- 144 (30.14/17.58) INELYDLEEEYY.SSQYK
---------------------------------------------------------------------------
|