<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32678
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASSRGMALYADEQQKMRFQVELEFVQCLANPNYLNYLAQRGNFKEPTFINYLKYLLYWREPEYAKYLKYPQCLHMLDLLQYESFRQELMNTHCARFIEDQQLLHWQHYLRTRTKLVQEQADLISKSTQPVTTTQTPTNTNSTSLSNQSNISQNFMSPITPNIFLK |
Length | 166 |
Position | Middle |
Organism | Helobdella robusta (Californian leech) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Annelida> Clitellata>
Hirudinea> Rhynchobdellida> Glossiphoniidae> Helobdella.
|
Aromaticity | 0.13 |
Grand average of hydropathy | -0.595 |
Instability index | 46.75 |
Isoelectric point | 8.39 |
Molecular weight | 19765.30 |
Publications | PubMed=23254933
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP32678
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 136.39| 38| 44| 23| 60| 1
---------------------------------------------------------------------------
23- 60 (69.79/46.52) LEFVQCLANPNYLNYLAQRGNFKEPTFINYL..KYLLYWR
68- 107 (66.61/44.09) LKYPQCLHMLDLLQYESFRQELMNTHCARFIedQQLLHWQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.92| 19| 21| 119| 137| 2
---------------------------------------------------------------------------
119- 137 (31.47/19.91) EQADLISKS..TQPVTTTQTP
141- 161 (27.45/16.61) NSTSLSNQSniSQNFMSPITP
---------------------------------------------------------------------------
|