<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32676
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MFGVMNVYESNLQKTWHDANWIPHLNHTNVLAYFSERTNPFYDKQCNNEIIKMQRLSPDKLQEMTGTEYILLHHQEPILYIIRQQNRQSPTISIPVADFYIIAGIVYQAPDLSTVINARILNAVHSLGSAFEETQNFSKYHPSRGYWWEFKDNNSQVDKNKKKEKKPAKNNIGTLFQRERVDLLLQDFSQRFTIKRAPEKIEEPIKGEMKMEPVKQEPSINQSAVNQPPIANQSASSAAASSSSSSMMIMMMNADRLSNKPNDKRMKTTR |
| Length | 270 |
| Position | Head |
| Organism | Helobdella robusta (Californian leech) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Annelida> Clitellata>
Hirudinea> Rhynchobdellida> Glossiphoniidae> Helobdella.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.704 |
| Instability index | 50.48 |
| Isoelectric point | 9.23 |
| Molecular weight | 31196.14 |
| Publications | PubMed=23254933
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP32676
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.17| 15| 17| 79| 93| 1
---------------------------------------------------------------------------
79- 93 (27.05/15.86) LYIIRQQNRQSPTIS
99- 113 (27.11/15.91) FYIIAGIVYQAPDLS
---------------------------------------------------------------------------
|