Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MFGVMNVYESNLQKTWHDANWIPHLNHTNVLAYFSERTNPFYDKQCNNEIIKMQRLSPDKLQEMTGTEYILLHHQEPILYIIRQQNRQSPTISIPVADFYIIAGIVYQAPDLSTVINARILNAVHSLGSAFEETQNFSKYHPSRGYWWEFKDNNSQVDKNKKKEKKPAKNNIGTLFQRERVDLLLQDFSQRFTIKRAPEKIEEPIKGEMKMEPVKQEPSINQSAVNQPPIANQSASSAAASSSSSSMMIMMMNADRLSNKPNDKRMKTTR |
Length | 270 |
Position | Head |
Organism | Helobdella robusta (Californian leech) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Annelida> Clitellata> Hirudinea> Rhynchobdellida> Glossiphoniidae> Helobdella. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.704 |
Instability index | 50.48 |
Isoelectric point | 9.23 |
Molecular weight | 31196.14 |
Publications | PubMed=23254933 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP32676 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 54.17| 15| 17| 79| 93| 1 --------------------------------------------------------------------------- 79- 93 (27.05/15.86) LYIIRQQNRQSPTIS 99- 113 (27.11/15.91) FYIIAGIVYQAPDLS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AASSSSSSMMIMMMNADRLSNKPND 2) YWWEFK | 239 146 | 263 151 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab