| Description | Uncharacterized protein |
| Sequence | MSNANSEKDRALQSIRSRADHLRHTITQLESRLAWYPLTQWPYFLSQFQVISKQLENIMTLKDDEELPESMHHFVCMPRMSTPNPADIPLLLRTREDPEMEKADDELLASERVNPLKRKASWTWEELEGQKLAHTDMVETLEKAFKEASDVLLKEIRVGKFQEKVKPVSTQSAVYKYMESGQWTN |
| Length | 185 |
| Position | Head |
| Organism | Saprolegnia diclina (strain VS20) |
| Kingdom | Oomycetes |
| Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Saprolegniales> Saprolegniaceae> Saprolegnia. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.722 |
| Instability index | 47.44 |
| Isoelectric point | 5.62 |
| Molecular weight | 21635.37 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP32673
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.34| 14| 15| 90| 103| 2
---------------------------------------------------------------------------
90- 103 (24.10/13.13) LLLRTREDPEMEKA
107- 120 (22.25/11.70) LLASERVNPLKRKA
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) IPLLLR 2) VYKYME | 88 174 | 93 179 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab