<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32673
| Description |
Uncharacterized protein |
| Sequence | MSNANSEKDRALQSIRSRADHLRHTITQLESRLAWYPLTQWPYFLSQFQVISKQLENIMTLKDDEELPESMHHFVCMPRMSTPNPADIPLLLRTREDPEMEKADDELLASERVNPLKRKASWTWEELEGQKLAHTDMVETLEKAFKEASDVLLKEIRVGKFQEKVKPVSTQSAVYKYMESGQWTN |
| Length | 185 |
| Position | Head |
| Organism | Saprolegnia diclina (strain VS20) |
| Kingdom | Oomycetes |
| Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Saprolegniales> Saprolegniaceae>
Saprolegnia.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.722 |
| Instability index | 47.44 |
| Isoelectric point | 5.62 |
| Molecular weight | 21635.37 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32673
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.34| 14| 15| 90| 103| 2
---------------------------------------------------------------------------
90- 103 (24.10/13.13) LLLRTREDPEMEKA
107- 120 (22.25/11.70) LLASERVNPLKRKA
---------------------------------------------------------------------------
|