Description | Uncharacterized protein |
Sequence | MSNANSEKDRALQSIRSRADHLRHTITQLESRLAWYPLTQWPYFLSQFQVISKQLENIMTLKDDEELPESMHHFVCMPRMSTPNPADIPLLLRTREDPEMEKADDELLASERVNPLKRKASWTWEELEGQKLAHTDMVETLEKAFKEASDVLLKEIRVGKFQEKVKPVSTQSAVYKYMESGQWTN |
Length | 185 |
Position | Head |
Organism | Saprolegnia diclina (strain VS20) |
Kingdom | Oomycetes |
Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Saprolegniales> Saprolegniaceae> Saprolegnia. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.722 |
Instability index | 47.44 |
Isoelectric point | 5.62 |
Molecular weight | 21635.37 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32673 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 46.34| 14| 15| 90| 103| 2 --------------------------------------------------------------------------- 90- 103 (24.10/13.13) LLLRTREDPEMEKA 107- 120 (22.25/11.70) LLASERVNPLKRKA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IPLLLR 2) VYKYME | 88 174 | 93 179 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab