<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32659
Description |
Uncharacterized protein |
Sequence | MDTSRDSSNLLDTHNRLIADVLSRFRMLTMLATIQAEGERKNAEPQTVAVTGMSMQMEFEGLHTSVKDLLALSRRLKELWLFGKLGAGESDARIQADKLQADVVRCAELLNAIQETRYSGLAAAAGGKWAPIGRQDAAAAAPPPATAPEGGAAATTAATQPGGAGAS |
Length | 167 |
Position | Head |
Organism | Colletotrichum gloeosporioides (strain Cg-14) (Anthracnose fungus) (Glomerella cingulata) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum>
Colletotrichum gloeosporioides species complex.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.181 |
Instability index | 32.34 |
Isoelectric point | 5.70 |
Molecular weight | 17475.60 |
Publications | PubMed=23902260
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32659
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.72| 15| 15| 117| 131| 1
---------------------------------------------------------------------------
117- 131 (28.19/13.45) RYSGLAAAAGGKWAP
134- 148 (27.53/12.99) RQDAAAAAPPPATAP
---------------------------------------------------------------------------
|