<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32651
Description |
RNA polymerase II holoenzyme cyclin-like subunit |
Sequence | MSANYWTSSQRLHWLLTKETLAERRKGLEDIFDPGKLQTIKALNPWHVRVYLHTLIHLLGQNLSIRQRILATAEVYLTRFHTKVPFGEINPYLVVATAVYVACKVEEHPQHIRTITSEARSLWPDYISHDPTKIAECEFYLIEELGTYLVIFHPYKSLMQISDAMARSNAQITMAPEEIQVTWSMINDSYITDLHLLNPPHIVAMACIYMTVVLRSHIMRMTMPSEAVKSRIEAFMTFFGESNVDLEQTIDCVQEMISLYVNWDTYSEKQCRVEIAKVIT |
Length | 280 |
Position | Kinase |
Organism | Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Dipodascaceae> Yarrowia.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.033 |
Instability index | 50.74 |
Isoelectric point | 6.05 |
Molecular weight | 32468.27 |
Publications | PubMed=15229592
|
Function
Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The SRB8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II (By similarity).
ECO:0000250
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP32651
No repeats found
|