<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32649
| Description |
RNA polymerase II holoenzyme cyclin-like subunit |
| Sequence | MSADFWCSSQRNKWQLSRQSLLEARRKVLLLERKMIQNGLIKDYPNIHYDFNMRIYLHNLLIKLGRRLNIRQVALATAEIYLNRFLTRVSLKEINVYLLVTTCLYVACKIEECPQHIRLIISEARNLWPEYIPHDVTKLAEFEFYLIEEMDSYLFLHHPYKSLIQIRDFLNENSAVFGFTLTDDELQNAWSLVNDSYITDLHLLLPPHIIAVASIYITIVLKKNLSAIRVNSSAVNSNGGPNSMMFNRNPDQNSMHIDDLMILANPSTPGSDLVNNLERTNFHDMKLDEETIKINKFMNFLDHSHINLDEVVEAMQDMINIYVQWNRYNEQGVKKALQVMLLNRQL |
| Length | 346 |
| Position | Kinase |
| Organism | Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Scheffersomyces.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.167 |
| Instability index | 48.89 |
| Isoelectric point | 6.31 |
| Molecular weight | 40544.38 |
| Publications | PubMed=17334359
|
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The SRB8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II (By similarity).
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by galactose GO:0000411 IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle GO:0010673 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP32649
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 78.47| 21| 21| 299| 319| 2
---------------------------------------------------------------------------
285- 299 (15.57/ 7.04) ......MKLDEETIKINKFMN
300- 320 (35.19/24.56) FLDHSHINLDEVVEAMQDMIN
322- 341 (27.72/17.89) YVQWNRYNEQGVKKALQVML.
---------------------------------------------------------------------------
|