<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32647
| Description |
RNA polymerase II holoenzyme cyclin-like subunit |
| Sequence | MAANFWESTQRRNWLFTKEELAARRQQLENEDPSLVTMYPLPEWRHLYNYFNYQMLRLAKNLSIRQQAIATAQVYMKRFYTRVEIRSTNPTLVLVTAVYLACKMEEMPLHIRNVSLEAKKVWPMETPSLEIAKIGECEFWLISEMSAQLIVHQPYRTLTALQQDFQLANDDHVLAVSFLNDHFMTDLPLLYAPHTIALAAIMLALVLRLSKASSSNNAAAGQQGGAQAGPLGITLASGLSMFQQAVAAKAMTPGGSGSPAMSSPIQQNPPNQAYQLTPQQQEMFRQQQMQQQNRQPETQAKDSPQKEKSKLQRFAAWLSESGVDIEAMIDCTQELIAFYECQESYNEQITRDQINRFVKARGL |
| Length | 363 |
| Position | Kinase |
| Organism | Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Magnaporthales> Pyriculariaceae> Pyricularia.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.349 |
| Instability index | 58.87 |
| Isoelectric point | 6.62 |
| Molecular weight | 41255.74 |
| Publications | PubMed=15846337
|
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The SRB8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II (By similarity).
ECO:0000250
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32647
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 248.11| 79| 174| 58| 144| 1
---------------------------------------------------------------------------
58- 144 (117.87/88.10) LAKNLSIRQQAIAtAQVYMKRFYTRVEIRS...TNPTlvlVTAVYLACKMEEMplhIRNVSLEAKKVWP....METPSLEIAKIGECEFWLiSE
235- 320 (130.24/74.75) LASGLSMFQQAVA.AKAMTPGGSGSPAMSSpiqQNPP...NQAYQLTPQQQEM...FRQQQMQQQNRQPetqaKDSPQKEKSKLQRFAAWL.SE
---------------------------------------------------------------------------
|