<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32642

Description RNA polymerase II holoenzyme cyclin-like subunit
SequenceMAANYWESTQRKHWQFTKQDLAAIRQRLDDEDPGLVQMFPLPQLRHLNIYFNQQINRLSKRIGLRQQVMATAQVYLKRFYTRIAIRQTNPYLVLTTVLYLACKMEECPQHIRMMTQEARSLWPSDLHGHDPARVGECEFSLISEMHSNLIVHQPYRSLLGVQDEFGLTQDEMSLAWTVINDHYMTDLPLLHPPHVVALTAVLLALVLRPSANTPAAGGAGGNAGAAAAAAAAGAGGVAMAATALAQAQAQVQARAAAIAAAGAGGGTPGFGSQGSQQQAGFSQGNSQGSLQGDSAAAEPKKVTDPRLAKVQRFAAWLADSNIDIEAMVDCTQELISFYECHEQYNDKHTKEQISRFIKARNLDK
Length364
PositionKinase
OrganismChaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Sordariales> Chaetomiaceae> Chaetomium.
Aromaticity0.07
Grand average of hydropathy-0.244
Instability index51.93
Isoelectric point6.86
Molecular weight39848.80
Publications
PubMed=25720678

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity). 
ECO:0000250
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
cyclin-dependent protein serine/threonine kinase regulator activity	GO:0016538	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP32642
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     115.98|      26|      28|     211|     236|       1
---------------------------------------------------------------------------
  211-  236 (44.84/17.61)	ANTPAAGGAGGNAGAAAAAAAAGAGG
  241-  265 (39.12/14.63)	ATALAQAQAQVQAR.AAAIAAAGAGG
  274-  297 (32.02/10.95)	GSQQQAGFSQGNSQGSLQGDSAAA..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.48|      20|      22|      55|      76|       2
---------------------------------------------------------------------------
   48-   72 (28.77/17.88)	NIYFnqqinRLSKRIGLRQQ....VMATA
   73-   97 (24.72/12.05)	QVYL....kRFYTRIAIRQTnpylVLTTV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      32.07|      13|      38|     139|     155|       3
---------------------------------------------------------------------------
  125-  143 (18.18/ 7.73)	DLHG....HDPA...rvgeceFSLIS
  144-  169 (13.90/13.36)	EMHSnlivHQPYrsllgvqdeFGLTQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32642 with CycC domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) TPGFGSQGSQQQAGFSQGNSQGSLQGDSAAAEPKKVT
267
303










Molecular Recognition Features






MoRF SequenceStartStop




NANANA