<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32630

Description Serine/threonine-protein kinase SSN3
SequenceMASNSILTLGPFKHRKDLTRESVLSTYQIIGYIAAGTYGKVYKAKLKNTASAEQLFAIKKFKSDNHSSNRSHHNHDINGNEIVHYTGISQSAIREMSLCRELNNKNITKLVDIILENKSIYMIFEFCEHDLLQIIHYHSHPEVKPIPQATVKSLIWQILNGVTFLHQNWIFHRDLKPANIMVSSSGVVKIGDLGLARKFNNPLQSLYTGDKVVVTIWYRAPELLLGARHYTPAIDLWAVGCILAELLSLRPIFKGEEAKIDINNKKSVPFQKNQFQKIVEVLGTPSMKNWPALNKYPEFISFQQQLTTNYPPNLVNWYKMIGSSNKQCLELLKGLLEYDPLVRLTADNALVHPYFLELPKVQENAFEGLNLKYPKRRIYTDDNDIISNQAINQNFKRHGGAYDDQHNNSNNNTNNSLNANNANNVPRKRAR
Length431
PositionKinase
OrganismScheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Scheffersomyces.
Aromaticity0.09
Grand average of hydropathy-0.418
Instability index35.37
Isoelectric point9.38
Molecular weight49250.78
Publications
PubMed=17334359

Function

Annotated function Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity). 
ECO:0000250
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblFungi
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IEA:UniProtKB-EC
metal ion binding	GO:0046872	IEA:UniProtKB-KW
protein serine kinase activity	GO:0106310	IEA:RHEA
protein threonine kinase activity	GO:0106311	IEA:RHEA
RNA polymerase II CTD heptapeptide repeat kinase activity	GO:0008353	IEA:UniProtKB-EC
GO - Biological Process
negative regulation of filamentous growth	GO:0060258	IEA:EnsemblFungi
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:EnsemblFungi
nuclear-transcribed mRNA catabolic process, non-stop decay	GO:0070481	IEA:EnsemblFungi
phosphorylation of RNA polymerase II C-terminal domain	GO:0070816	IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter by galactose	GO:0000435	IEA:EnsemblFungi
protein destabilization	GO:0031648	IEA:EnsemblFungi
response to oxidative stress	GO:0006979	IEA:EnsemblFungi

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP32630
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.89|      16|      26|     275|     290|       1
---------------------------------------------------------------------------
  275-  290 (29.52/20.80)	FQKIVEVLGTPSMKNW
  302-  317 (31.38/22.58)	FQQQLTTNYPPNLVNW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.77|      19|      32|     332|     351|       3
---------------------------------------------------------------------------
  332-  351 (28.30/24.62)	LKGL.LEYdPLVRL.TADNALV
  366-  386 (26.47/17.15)	FEGLnLKY.PKRRIyTDDNDII
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     138.19|      41|      96|      93|     137|       4
---------------------------------------------------------------------------
   93-  137 (66.53/57.32)	IREMSLCRELNNknitKLVDIILENKSIYMIFEFCEHDLLQIIHY
  190-  230 (71.66/51.35)	IGDLGLARKFNN....PLQSLYTGDKVVVTIWYRAPELLLGARHY
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32630 with CDK8 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KRHGGAYDDQHNNSNNNTNNSLNANNANNVPRKRAR
396
431










Molecular Recognition Features






MoRF SequenceStartStop




1) LFAIKK
55
60