<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32629

Description Serine/threonine-protein kinase SSN3
SequenceMERKRGREMNPPSADPPSATPVARANLPGSVAAAFHGRPCSQGTTTLKRVNERYKIVGFISSGTYGRVYKAEGKNGRTGEFAIKKFKPDKEGELQYSGISQSAIREMALCTELAHPNVVHTVEIILEEKCIFIVFEYAEHDLLQIIHHHNQPQRQAIPARTIKSILYQLLQGLVYLHRNWVMHRDLKPANIMVTSAGKVKIGDLGLARLFYKPLQSLFSGDKVVVTIWYRAPELLLGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVEIMGMPSKDRWPLLTAMPEYPQLSSLIAGNAARFARPQGGDGLDRWYNQTLINNQYPAGPGPETPGAEGLALLKQLLEYDPQKRLTAEKALEHRYFTEHGKPSDNCFEDSKIKYPVRRVSQEDNDIRTSSLPGTKRSGLPDDSLMGRPAKRLKEG
Length443
PositionKinase
OrganismPhaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Phaeosphaeriaceae> Parastagonospora.
Aromaticity0.08
Grand average of hydropathy-0.471
Instability index45.04
Isoelectric point9.45
Molecular weight49755.68
Publications
PubMed=18024570

Function

Annotated function Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity). 
ECO:0000250
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
nucleus	GO:0005634	IBA:GO_Central
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IBA:GO_Central
metal ion binding	GO:0046872	IEA:UniProtKB-KW
protein serine kinase activity	GO:0106310	IEA:RHEA
protein threonine kinase activity	GO:0106311	IEA:RHEA
RNA polymerase II CTD heptapeptide repeat kinase activity	GO:0008353	IBA:GO_Central
GO - Biological Process
protein phosphorylation	GO:0006468	IBA:GO_Central

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP32629
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.08|      25|      32|     367|     398|       1
---------------------------------------------------------------------------
  380-  407 (42.10/35.54)	EHRYFTEHGKPSDNCFEDSkikY.PVRRV
  413-  440 (33.99/16.91)	DIRTSSLPGTKRSGLPDDS.lmGrPAKRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.37|      12|     123|     202|     214|       3
---------------------------------------------------------------------------
  202-  213 (21.79/13.70)	GDLGLARLFYKP
  232-  243 (22.58/ 9.21)	PELLLGSRHYTP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32629 with CDK8 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) RRVSQEDNDIRTSSLPGTKRSGLPDDSLMGRPAKRLKEG
405
443










Molecular Recognition Features






MoRF SequenceStartStop




1) LMGRPAKRLKE
432
442