<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32627
| Description |
Serine/threonine-protein kinase SSN3 |
| Sequence | MSHSNPPTGASGGPGSASASAAPARGYYSLKRSIQTAFNDPLDRGLGPPAYQSKVRVMDKYQVIGFISSGTYGRVYKARGRQGQPGEFAIKKFKPDKEGEQITYTGISQSAIREMALCSELRHPNVIRLVETILEDKAIFMVFEYAEHDLLQIIHHHTQQPKHPIPPQTIKSIMFQLLNGCQYLHTNWVLHRDLKPANIMVTSSGEVKVGDLGLARIFWKPVRTLMQGDKVVVTIWYRAPELLMGSHHYTPAVDMWAVGCIFAELLSLRPIFKGEEAKMDNTKKGGSRDMPFQRHQMQKIVDIMGMPTKERWPLLTSMPDYDKLPLLQPPLSASGYSQQPAHSHHHHQHYNQGPQYGGRAGGPTSSSSANSSSAAAAASQSHLDKWYYHTVSQGQTAGPMPHAPPGSLASLGVEGYKLLAGLLEYDPEKRLTAAAALQHNFFSTGDRVSANCFEGCKAEYPHRRVSQEDNDIRTGSVPGTKRSGMPDDSMGRPGKRVKE |
| Length | 499 |
| Position | Kinase |
| Organism | Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Magnaporthales> Pyriculariaceae> Pyricularia.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.521 |
| Instability index | 40.68 |
| Isoelectric point | 9.27 |
| Molecular weight | 55093.02 |
| Publications | PubMed=15846337
|
Function
| Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The SRB8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II (By similarity).
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-KW
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:UniProtKB-EC
metal ion binding GO:0046872 IEA:UniProtKB-KW
protein serine kinase activity GO:0106310 IEA:RHEA
protein threonine kinase activity GO:0106311 IEA:RHEA
RNA polymerase II CTD heptapeptide repeat kinase activity GO:0008353 IEA:UniProtKB-EC
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32627
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 58.22| 12| 15| 217| 228| 1
---------------------------------------------------------------------------
217- 228 (23.23/13.83) IFWK..PVRTLMQG
235- 245 (20.29/11.21) IWYR..APELLM.G
261- 274 (14.70/ 6.23) IFAEllSLRPIFKG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.43| 26| 187| 280| 309| 2
---------------------------------------------------------------------------
280- 309 (42.35/36.51) DNTKKGGSrdMP.FQRHQMQKivDIMGMPTK
469- 495 (46.08/27.02) DNDIRTGS..VPgTKRSGMPD..DSMGRPGK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 104.90| 28| 35| 342| 371| 3
---------------------------------------------------------------------------
342- 371 (49.34/34.47) HSHHHHQHYNQGPQygGRAGGPTSSSSANS
380- 407 (55.56/32.03) QSHLDKWYYHTVSQ..GQTAGPMPHAPPGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.91| 11| 37| 414| 430| 5
---------------------------------------------------------------------------
414- 430 (11.90/20.16) EGYKllaglLEYdPEKR
454- 464 (24.01/13.17) EGCK.....AEY.PHRR
---------------------------------------------------------------------------
|