Description | Serine/threonine-protein kinase SSN3 |
Sequence | MSHSNPPTGASGGPGSASASAAPARGYYSLKRSIQTAFNDPLDRGLGPPAYQSKVRVMDKYQVIGFISSGTYGRVYKARGRQGQPGEFAIKKFKPDKEGEQITYTGISQSAIREMALCSELRHPNVIRLVETILEDKAIFMVFEYAEHDLLQIIHHHTQQPKHPIPPQTIKSIMFQLLNGCQYLHTNWVLHRDLKPANIMVTSSGEVKVGDLGLARIFWKPVRTLMQGDKVVVTIWYRAPELLMGSHHYTPAVDMWAVGCIFAELLSLRPIFKGEEAKMDNTKKGGSRDMPFQRHQMQKIVDIMGMPTKERWPLLTSMPDYDKLPLLQPPLSASGYSQQPAHSHHHHQHYNQGPQYGGRAGGPTSSSSANSSSAAAAASQSHLDKWYYHTVSQGQTAGPMPHAPPGSLASLGVEGYKLLAGLLEYDPEKRLTAAAALQHNFFSTGDRVSANCFEGCKAEYPHRRVSQEDNDIRTGSVPGTKRSGMPDDSMGRPGKRVKE |
Length | 499 |
Position | Kinase |
Organism | Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Magnaporthales> Pyriculariaceae> Pyricularia. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.521 |
Instability index | 40.68 |
Isoelectric point | 9.27 |
Molecular weight | 55093.02 |
Publications | PubMed=15846337 |
Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The SRB8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II (By similarity).
ECO:0000250 |
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell |
GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-KW cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:UniProtKB-EC metal ion binding GO:0046872 IEA:UniProtKB-KW protein serine kinase activity GO:0106310 IEA:RHEA protein threonine kinase activity GO:0106311 IEA:RHEA RNA polymerase II CTD heptapeptide repeat kinase activity GO:0008353 IEA:UniProtKB-EC |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP32627 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 58.22| 12| 15| 217| 228| 1 --------------------------------------------------------------------------- 217- 228 (23.23/13.83) IFWK..PVRTLMQG 235- 245 (20.29/11.21) IWYR..APELLM.G 261- 274 (14.70/ 6.23) IFAEllSLRPIFKG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 88.43| 26| 187| 280| 309| 2 --------------------------------------------------------------------------- 280- 309 (42.35/36.51) DNTKKGGSrdMP.FQRHQMQKivDIMGMPTK 469- 495 (46.08/27.02) DNDIRTGS..VPgTKRSGMPD..DSMGRPGK --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 104.90| 28| 35| 342| 371| 3 --------------------------------------------------------------------------- 342- 371 (49.34/34.47) HSHHHHQHYNQGPQygGRAGGPTSSSSANS 380- 407 (55.56/32.03) QSHLDKWYYHTVSQ..GQTAGPMPHAPPGS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 35.91| 11| 37| 414| 430| 5 --------------------------------------------------------------------------- 414- 430 (11.90/20.16) EGYKllaglLEYdPEKR 454- 464 (24.01/13.17) EGCK.....AEY.PHRR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) SMGRPGKRVK 2) YYSLKR | 489 27 | 498 32 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab