<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32626

Description Serine/threonine-protein kinase SSN3
SequenceMYGNQQNNSNPYQMSYYRMNNGQGQGTNRWPQQLSHQEMLAGHSQQILNNNKPAGNQSKPPIVMASNNVFSIGPYRQRKDSSRISVLQKYEIIGYIAAGTYGKVYKAKARDYQNGMNRDNVIILDSPDSVSADSNLDINSINRSTRQQEANDNLTTMDFRKPSHKRFTPPNNSNSTQIRSNSGSETNVRINSSSITNNSRKPSQIQFYAIKKFKTEREGVEHYTGISQSACREMSLCRELDNNHLTKLVEIFLEKKSIYMVSEFAEHDLLQIIHFHSHPEKRLIPPRMLKSIMWQILDGVSYLHQNWILHRDLKPANIMVTVDGCVKIGDLGLARKFNNMVQTLYTGDKVIVTIWYRAPELILGARHYTPAIDLWAVGCIFAELIGLRPIFKGEEAKMESKKSVLFQANQFQKILEVMGSPDHKIWPNIDSYPEYLQLAKMPKYRDNLTAWYQTAGGKDKTALDILYRLLQYDPIKRIDAIDALDHVYFTNGDPPVCENVFEGLNYKYPPRRIHTNDNDITNVGNDNNQANHSQKQPMHGNNNNKNGNMNGLGVNKRILAAAAAAAAAAAVSGNGNNPTSNTATGGSARKKRK
Length593
PositionKinase
OrganismKluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Kluyveromyces.
Aromaticity0.08
Grand average of hydropathy-0.664
Instability index39.05
Isoelectric point9.44
Molecular weight67011.96
Publications
PubMed=15116433
PubMed=15229592

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity). 
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblFungi

GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IEA:UniProtKB-EC
metal ion binding	GO:0046872	IEA:UniProtKB-KW
protein serine kinase activity	GO:0106310	IEA:RHEA
protein threonine kinase activity	GO:0106311	IEA:RHEA
RNA polymerase II CTD heptapeptide repeat kinase activity	GO:0008353	IEA:UniProtKB-EC

GO - Biological Process
negative regulation of filamentous growth	GO:0060258	IEA:EnsemblFungi
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:EnsemblFungi
nuclear-transcribed mRNA catabolic process, non-stop decay	GO:0070481	IEA:EnsemblFungi
phosphorylation of RNA polymerase II C-terminal domain	GO:0070816	IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter by galactose	GO:0000435	IEA:EnsemblFungi
protein destabilization	GO:0031648	IEA:EnsemblFungi
response to oxidative stress	GO:0006979	IEA:EnsemblFungi









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32626
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.95|      14|      32|     540|     553|       1
---------------------------------------------------------------------------
  540-  553 (28.04/14.87)	GNNNNKNGNMNGLG
  573-  586 (26.91/13.97)	GNGNNPTSNTATGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      94.72|      35|      53|     324|     375|       2
---------------------------------------------------------------------------
  318-  371 (44.75/66.31)	IMVTvdGCVKIGDLGL....................ARKFNNMVQTLYTGDKvivTIWyrapelilgarhytPA
  372-  428 (49.97/33.25)	IDLWavGCIFAELIGLrpifkgeeakmeskksvlfqANQFQKILEVMGSPDH...KIW..............PN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.24|      20|      32|     470|     493|       3
---------------------------------------------------------------------------
  470-  493 (28.22/28.15)	LQYD.PIKRIDAIDAlDhvyFTN.GD
  504-  525 (31.03/16.83)	LNYKyPPRRIHTNDN.D...ITNvGN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.22|      18|      19|      11|      28|       4
---------------------------------------------------------------------------
    6-   25 (31.99/17.49)	QNNsnPYQMSYYRMNNGQGQ
   26-   45 (29.24/15.42)	GTNrwPQQLSHQEMLAGHSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     116.58|      35|      37|     133|     167|       6
---------------------------------------------------------------------------
  133-  167 (61.49/43.43)	DSN.LDINSINRSTRQQEANDNLTTMDFRKPSHKRF
  172-  207 (55.09/38.09)	NSNsTQIRSNSGSETNVRINSSSITNNSRKPSQIQF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32626 with CDK8 domain of Kingdom Fungi
Unable to open file!