<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32621

Description Serine/threonine-protein kinase SSN3
SequenceMNNHYHPTGHRDAKTYAGDRPWPQWPGVPSGLSSSSGLLQNRYYAPAGPFPLLPYFGELGAGPDTAMNQAKRQRAEVSYQQPRPYPTGRGTGSMGYQSKVRVTDKYKVVGFISSGTYGRVYKALGRHGQPGEFAIKKFKPDKEGEQASYTGISQSAVREMALCSELHHPNVIRLVEIILEDKCIFMVFEYAEHDLLQIIHHHTQQPRHPIPPNTIKSIMFQLLNGCQYLHTNWVLHRDLKPANIMVTSSGEVKIGDLGLARLSYKPLHSLYGGDKVVVTIWYRAPELLLGSRHYTPAIDMWALGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVDIMGLPTKERWPLLTSTTEYSQLSTLQPPIHHGGHHGHHYQSQRQAAAANAGVSHLEKWYYNTINQQTGGSGPGSGTSPLASLGAEGYKLLAGLLEYDPQRRLTAAAALQHPFFSTGDPVSANCFEGLKTEYPHRRVSQDDNDIRTSSLPGTKRSGLPDDSLRPGKRVKEG
Length512
PositionKinase
OrganismChaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Sordariales> Chaetomiaceae> Chaetomium.
Aromaticity0.09
Grand average of hydropathy-0.538
Instability index39.62
Isoelectric point9.29
Molecular weight56983.02
Publications
PubMed=25720678

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity). 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IEA:UniProtKB-EC
metal ion binding	GO:0046872	IEA:UniProtKB-KW
protein serine kinase activity	GO:0106310	IEA:RHEA
protein threonine kinase activity	GO:0106311	IEA:RHEA
RNA polymerase II CTD heptapeptide repeat kinase activity	GO:0008353	IEA:UniProtKB-EC

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32621
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     308.20|      91|     283|      76|     169|       1
---------------------------------------------------------------------------
   76-  169 (147.40/79.24)	EVSYQQPrPYPTGrGTGSMGYQSKVRVTDKYKVVGFISSGTYGRVYKALGRHGqPGEFAIKKFKPDKEGEQASYTGISQSAVREMALCSELHHP
  363-  453 (160.80/76.33)	QLSTLQP.PIHHG.GHHGHHYQSQRQAAAANAGVSHLEKWYYNTINQQTGGSG.PGSGTSPLASLGAEGYKLLAGLLEYDPQRRLTAAAALQHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.90|      18|     434|      53|      72|       2
---------------------------------------------------------------------------
   53-   72 (28.85/19.66)	LPyfGELGAG.PDTAMNQAKR
  490-  508 (30.05/13.90)	LP..GTKRSGlPDDSLRPGKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      91.49|      26|     253|      16|      47|       3
---------------------------------------------------------------------------
   16-   47 (45.40/37.59)	YAGDR.PWPQWPGVPSgLssssgLLQNRYYAPA
  271-  297 (46.08/23.76)	YGGDKvVVTIWYRAPE.L.....LLGSRHYTPA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32621 with CDK8 domain of Kingdom Fungi
Unable to open file!