<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32616
| Description |
Serine/threonine-protein kinase ssn3 |
| Sequence | MFGRSFPFYNSLGGFYPQSLDARKPPGSGYTSKVRVRDRYHIVGFISSGTYGRVYKAIGKNGQKGEFAIKKFKPDKEGEIIQYTGLSQSAIREMALCSELDHPNVVQLAEIILEDKCIFMVFEYTEHDLLQIIHHHTQPQRHAIPALMVRSILFQLLNGLLYLHTNWVLHRDLKPANILVTSSGAIRIGDLGLARLFYKPLNSLFSGDKVVVTIWYRAPELLMGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIIEIMGLPTKEIWPGIVSMPEYSQLQSLAMSRAPGHFNRSSNLEGWYQSCLKNNGYSANSSAGTPGADGFDLLSRLLEYDPTKRITAQEALEHPYFKNGGPISANCFEGFEGKYPHRRVTQDDNDIRSGSLPGTKRSGLPDDSLLGRATKRLKE |
| Length | 427 |
| Position | Kinase |
| Organism | Aspergillus niger (strain CBS 513.88 / FGSC A1513) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.313 |
| Instability index | 44.18 |
| Isoelectric point | 9.19 |
| Molecular weight | 48036.62 |
| Publications | PubMed=17259976
|
Function
| Annotated function |
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The srb8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II (By similarity).
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-KW
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:UniProtKB-EC
metal ion binding GO:0046872 IEA:UniProtKB-KW
protein serine kinase activity GO:0106310 IEA:RHEA
protein threonine kinase activity GO:0106311 IEA:RHEA
RNA polymerase II CTD heptapeptide repeat kinase activity GO:0008353 IEA:UniProtKB-EC
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32616
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 125.77| 38| 90| 115| 157| 4
---------------------------------------------------------------------------
115- 157 (55.74/48.03) DKCIFMVFeYTEHDLLQIIHHHTqPqrhAIPALMVRSILFQLL
208- 245 (70.03/41.69) DKVVVTIW.YRAPELLMGSRHYT.P...AVDLWAVGCIFAELL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.16| 18| 278| 5| 27| 5
---------------------------------------------------------------------------
5- 27 (29.66/35.27) SFPFYNSLggfypQSLDARKPPG
291- 308 (34.51/23.31) SMPEYSQL.....QSLAMSRAPG
---------------------------------------------------------------------------
|