<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32614

Description Serine/threonine-protein kinase ssn3
SequenceMFGRNFPFFNSIGGFYPRDSLDPRKPSGTGYTSKVRVRDKYHIVGFISSGTYGRVYKAIGKDGRKGEFAIKKFKPDKEGEIIQYTGLSQSAIREMSLCSELDHSNVVQLAEIILEDKCIFMVFEYTEHDLLQIIHHHTQPQRHAIPAPMIKSILFQLLNGLLYLHTNWVLHRDLKPANILVTSSGAVRIGDLGLARLFYKPLNSLYSGDKVVVTIWYRAPELLMGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIVEIMGLPRKETWPGLVAMPEFSQLQSLAMARGHLNRQSNLEGWYQSCLKNNGYSPTSSAGTPGPEGFDLLSRLLEYDPLKRISAQEALEHPYFTTGTPITANCFAGYEGKYPHRRVTQDDNDIRSGSLPGTKRSGLPDDSLMGRAAKRLKE
Length426
PositionKinase
OrganismAspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Fumigati.
Aromaticity0.10
Grand average of hydropathy-0.339
Instability index38.85
Isoelectric point9.25
Molecular weight48034.71
Publications
PubMed=18404212

Function

Annotated function Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The srb8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity). 
ECO:0000250
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IEA:UniProtKB-EC
metal ion binding	GO:0046872	IEA:UniProtKB-KW
protein serine kinase activity	GO:0106310	IEA:RHEA
protein threonine kinase activity	GO:0106311	IEA:RHEA
RNA polymerase II CTD heptapeptide repeat kinase activity	GO:0008353	IEA:UniProtKB-EC
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32614
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     100.45|      30|     149|     125|     202|       2
---------------------------------------------------------------------------
  125-  158 (45.05/89.35)	YTEHDLLQIIHHHTqPqrhAIPAPMIKSILFQLL
  217-  246 (55.40/15.90)	YRAPELLMGSRHYT.P...AVDLWAVGCIFAELL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32614 with CDK8 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) RRVTQDDNDIRSGSLPGTKRSGLPDDSLMGRAAKRL
389
424










Molecular Recognition Features






MoRF SequenceStartStop




1) LMGRAAKRLKE
416
426