<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32614
| Description |
Serine/threonine-protein kinase ssn3 |
| Sequence | MFGRNFPFFNSIGGFYPRDSLDPRKPSGTGYTSKVRVRDKYHIVGFISSGTYGRVYKAIGKDGRKGEFAIKKFKPDKEGEIIQYTGLSQSAIREMSLCSELDHSNVVQLAEIILEDKCIFMVFEYTEHDLLQIIHHHTQPQRHAIPAPMIKSILFQLLNGLLYLHTNWVLHRDLKPANILVTSSGAVRIGDLGLARLFYKPLNSLYSGDKVVVTIWYRAPELLMGSRHYTPAVDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIVEIMGLPRKETWPGLVAMPEFSQLQSLAMARGHLNRQSNLEGWYQSCLKNNGYSPTSSAGTPGPEGFDLLSRLLEYDPLKRISAQEALEHPYFTTGTPITANCFAGYEGKYPHRRVTQDDNDIRSGSLPGTKRSGLPDDSLMGRAAKRLKE |
| Length | 426 |
| Position | Kinase |
| Organism | Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Fumigati.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.339 |
| Instability index | 38.85 |
| Isoelectric point | 9.25 |
| Molecular weight | 48034.71 |
| Publications | PubMed=18404212
|
Function
| Annotated function |
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex. The srb8-11 complex
phosphorylates the C-terminal domain (CTD) of the largest subunit of
RNA polymerase II (By similarity).
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-KW
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:UniProtKB-EC
metal ion binding GO:0046872 IEA:UniProtKB-KW
protein serine kinase activity GO:0106310 IEA:RHEA
protein threonine kinase activity GO:0106311 IEA:RHEA
RNA polymerase II CTD heptapeptide repeat kinase activity GO:0008353 IEA:UniProtKB-EC
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32614
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 100.45| 30| 149| 125| 202| 2
---------------------------------------------------------------------------
125- 158 (45.05/89.35) YTEHDLLQIIHHHTqPqrhAIPAPMIKSILFQLL
217- 246 (55.40/15.90) YRAPELLMGSRHYT.P...AVDLWAVGCIFAELL
---------------------------------------------------------------------------
|