<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32613

Description Serine/threonine-protein kinase SSN3
SequenceMGIRLQSSDSMNNQHQTQQNKYFNVSNQASTRSLWSQQQQQQLLDTKGSASTSKSPMLMANNNVFSIGPYRQRKDAGRVSVLEKYEIIGYIAAGTYGKVYKAKAKETQEEQENSIHTHNQTLGSVSVAGIDGGMASREVENGGDDPLRLDGHGGIAVAPAAGGGLSSAAAHRARSNGAVKALPKKSAFTPFYAIKKFKTEREGVEQLHYTGISQSACREMSLCRELDNKHLTKLVEIFLERKSIYMVSEFAEHDLLQIIHFHSHPEKRLIAPRMLKSIMWQILDGVSYLHQNWILHRDLKPANIMVTVDGCVKIGDLGLARKFYNLVQTLYTGDKVVVTIWYRAPELLLGARHYSPAIDLWAVGCIFAELIGLRPIFKGEEAKMDSKKSVPFQGNQLQRILEVLGTPTHHTWPNIHKYPEYEQLSKFSKYRDNLSVWYHSSGGRDKAALSLLYSLLKYDPITRIDAIDALEHEYFTNNDPPVSSDVFEGLSYKYPPRRIHTSDNDIMNVGANKNKSGFNHHPPQQQTVNNNGVTNSSIGGLGVNRRILAAAAAAAAAVQVNGTNIVSGSSSSNGPIRKKKR
Length581
PositionKinase
OrganismAshbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Eremothecium.
Aromaticity0.08
Grand average of hydropathy-0.456
Instability index41.07
Isoelectric point9.39
Molecular weight64529.39
Publications
PubMed=15001715
PubMed=23749448

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II (By similarity). 
ECO:0000250
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
nucleus	GO:0005634	IBA:GO_Central
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IBA:GO_Central
metal ion binding	GO:0046872	IEA:UniProtKB-KW
protein serine kinase activity	GO:0106310	IEA:RHEA
protein threonine kinase activity	GO:0106311	IEA:RHEA
RNA polymerase II CTD heptapeptide repeat kinase activity	GO:0008353	IBA:GO_Central
GO - Biological Process
negative regulation of filamentous growth	GO:0060258	IEA:EnsemblFungi
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:EnsemblFungi
nuclear-transcribed mRNA catabolic process, non-stop decay	GO:0070481	IEA:EnsemblFungi
phosphorylation of RNA polymerase II C-terminal domain	GO:0070816	IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter by galactose	GO:0000435	IEA:EnsemblFungi
protein destabilization	GO:0031648	IEA:EnsemblFungi
protein phosphorylation	GO:0006468	IBA:GO_Central
response to oxidative stress	GO:0006979	IEA:EnsemblFungi

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP32613
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.18|      12|      19|     132|     143|       1
---------------------------------------------------------------------------
  132-  143 (22.35/13.89)	GGMASREVENGG
  153-  164 (21.83/13.40)	GGIAVAPAAGGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.23|      16|      19|     459|     474|       2
---------------------------------------------------------------------------
  459-  474 (28.09/23.81)	DPITRIDAIDALEHEY
  479-  494 (29.14/25.00)	DPPVSSDVFEGLSYKY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.60|      19|      21|      11|      31|       3
---------------------------------------------------------------------------
   11-   31 (30.16/30.74)	MNNQHQTQQnkYFNVSNQAST
   34-   52 (33.44/25.70)	LWSQQQQQQ..LLDTKGSAST
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.65|      20|      21|     257|     276|       4
---------------------------------------------------------------------------
  257-  276 (36.88/23.06)	QIIHFHSHPEKRLIAPRMLK
  281-  300 (36.77/22.98)	QILDGVSYLHQNWILHRDLK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.31|      14|      24|     495|     508|       5
---------------------------------------------------------------------------
  495-  508 (26.56/16.57)	PPRRIHTSDNDIMN
  522-  535 (25.74/15.86)	PPQQQTVNNNGVTN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.49|      18|      79|     342|     361|       6
---------------------------------------------------------------------------
  338-  355 (31.87/14.24)	VTIW.....YRAPELLLGARHYS
  409-  431 (28.62/18.43)	HHTWpnihkYPEYEQLSKFSKYR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32613 with CDK8 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GIRLQSSDSMNNQHQTQQNKYFNVSNQAST
2) TSDNDIMNVGANKNKSGFNHHPPQQQTVNNNGVTNS
2
501
31
536










Molecular Recognition Features






MoRF SequenceStartStop




1) GPIRKKKR
574
581