<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32611

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMHRPRSSWPNLVWDHSFPHHVLTQGKYTTIPYRTYICLQGNETSLKEAEWAIRNDNPRALVKSYNKELWTFTLQEGVTPPSALDRFQLTETTTGVFLPSTTTPSSLTMTKQLTPPGYVALMLAIEAMIQEALKRDDHYVPFGNNLILPVTGDLLHLDARLTPGGDLLLQMYQQETEWEMFGKRKRDVANEIVGTKVVVAPTLVEGVVENSTNQIPDNLPVLLEMLDCLCSVRLRAKKQWTAVRIDTEVLLWPTELLFVDRKSATGKLEDEGKDALLWTEDILDSVFEATQLIRRGESGVNTNESTAAQPQPAQNGTNSMAPAAGTTNATTQRNEENKQIYPTPPEAPKRILPGILLERATAPAGGWGELDEELFGGDEVTEADFNFFDDMGGDKNDTDGDNDNGNDNDNDKADAMDVDVKEEAKKEEMIKKETKEEVPVKEEVQEEEPDESATTAALLTNNPAEEKAVVHGVNDSSTVNGAVDAAVSATVVSSVPYLPSDFDQLIVNPAEQRTFALVEFNREAEQRLNDKYAAGGRFFVPDDSSSDNEGSSDNTGDSSDSGDGSESVPRDVKRQKVDEGTLSDQTDEPEIDAKQLHQQWSAILNYNHDDKPAKKIDSSNDTTNSDGNSNNSNYEEAVQRLAEQVVWDNSCYKGLVPQENYYRPPSARFVKVVEQVFGDTSKRLSLIDFAKMSDKGGQQQPGVGMPINAAAGTAGGGPGTPVTVSNASGVPSGSSGAQASQMGALAVGSALSPSRGATPQPEGSSPETRPSNWTPGITSQVNSAASSPVPLQQHQQQQQSFSPMSPQTPAQAPVPSANSFANAANAAPTQRLATPMYSFMRGGSLIKAQPPILRFWSTFGLSPRNGPKPLTLTLIYPSGTAIGDAAAAFLISFKMCYEGCGFGLVTLGGSNGTGVVSSDYKNLDVSREGVLLVSNPYNDVLGFLNLAKAAAAGSKTATSTSTILTLPCSIFASYTALRAPSAMLLAALCRNLYDHLPPTSTKRRYGSVIQRQAPACVISKPVPPFINFKLLANTPDSVINEDSLLHVAYAASNRWITCAWSDQWGELAKVKVFCLQSESGPLRTLEEVCTEIWETTLQLNGSTDVRSVAVAKLGGMLDDELAMWLRVSSVTRGRRITPFFLVVDNRPSMVVTGSDDGSKGGNVAGGPAPAPPTGAAGAASTGSAPMSTPFRDTDSPDIYNHVTTPSVGEDKIDYDDMSIVDVHDEIHSVTLNHRQPLTMHSTRLGLATGYLVKTSPLNPNQLLVFSLTFVNCPCVVMHVAMKHFLRQYRNLISLAATTGVCDPEYAIVPWHVEAVDKMMRLVEEL
Length1324
PositionKinase
OrganismYarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Dipodascaceae> Yarrowia.
Aromaticity0.07
Grand average of hydropathy-0.367
Instability index46.02
Isoelectric point4.83
Molecular weight143230.58
Publications
PubMed=15229592

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex (By similarity). 
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central

GO - Biological Function
transcription coregulator activity	GO:0003712	IBA:GO_Central

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32611
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.71|      14|      17|     695|     711|       1
---------------------------------------------------------------------------
  695-  711 (21.91/18.48)	GGqqqPGVGMPINAAAG
  715-  728 (25.80/13.00)	GG...PGTPVTVSNASG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      71.33|      17|      17|     411|     427|       3
---------------------------------------------------------------------------
  393-  407 (18.83/ 9.14)	..DKNDTDGDNDNGNDN
  411-  427 (26.70/16.13)	KADAMDVDVKEEAKKEE
  431-  447 (25.79/15.32)	KETKEEVPVKEEVQEEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      80.08|      16|      17|     785|     800|       4
---------------------------------------------------------------------------
  785-  800 (28.43/15.70)	SSPVPLQQHQQQQQSF
  804-  819 (27.85/15.20)	SPQTPAQAPVPSANSF
  825-  838 (23.80/11.75)	AAPT..QRLATPMYSF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.69|      17|      23|      73|      89|       6
---------------------------------------------------------------------------
   73-   89 (30.14/19.30)	LQEGVTPPSALDRFQLT
   97-  113 (29.54/18.74)	LPSTTTPSSLTMTKQLT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     128.50|      40|      51|     192|     231|       8
---------------------------------------------------------------------------
  192-  231 (68.61/37.09)	VGTKVVVAPTLVEGVVENS.TNQIPD.NLPVLLEMLDCLCSV
  244-  285 (59.89/31.54)	IDTEVLLWPTELLFVDRKSaTGKLEDeGKDALLWTEDILDSV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.64|      13|      22|     570|     591|       9
---------------------------------------------------------------------------
  555-  567 (22.52/26.21)	GDSSDSGDGSESV
  579-  591 (23.12/ 6.98)	GTLSDQTDEPEID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     197.10|      66|     650|     290|     363|      10
---------------------------------------------------------------------------
  290-  363 (97.36/87.52)	QLIRRGESGVNTNESTAA.QPQPAQ...NGTNSMAPAAGTTNATTqRNeenkqIYP.TPPEAPKRILpGILLERaTAPA
  944- 1014 (99.74/64.52)	NLAKAAAAGSKTATSTSTiLTLPCSifaSYTALRAPSAMLLAALC.RN.....LYDhLPPTSTKRRY.GSVIQR.QAPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.00|      21|      25|     116|     140|      11
---------------------------------------------------------------------------
  116-  140 (25.81/35.18)	GyVALMLAIEAmiqEALKRDDHYVP
  142-  162 (36.20/27.68)	G.NNLILPVTG...DLLHLDARLTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.59|      14|      26|     620|     633|      15
---------------------------------------------------------------------------
  620-  633 (24.95/13.45)	DTTNSDGNSNNSNY
  647-  660 (26.64/14.84)	DNSCYKGLVPQENY
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32611 with Med13 domain of Kingdom Fungi
Unable to open file!