<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32589

Description Mediator of RNA polymerase II transcription subunit 12
SequenceMIPHSSAGVQQWGHHPLHALNPGAGRTDTASALGPSDLQLEKAPMSAPQPQLRQPAVVDLTTHSGDTSEREPPSKRLRLDLPSVASTGDASPASGNGEPRNTPSTSTPTAKPSSLSWRGRPVWSFQALISEIPGSGGMSEEDAAAVAQSGKPASPPPFPVLPWKYAPPEAAGNKSVKSRDSSPAKKVQTTPYHIECPSVAPVLKGQKVADFSPWTGNHPEDVLNEQTAKQGHYDRTQVSQNESNTARPSLYAQLKHRSGLQMLSSVFAAALEKRQSHNLVNAPSTFKPPPRVTLTDNKREAWLRDLANPSVPLRRLSRTIPHGIRGKALLDQCLSKWIPVNRAVWLAKCVGANEIRAFKRKGTSGAVVIGLEAKWVREWTAHVQQFLEGLVAACGTADWKMKMTYAVGLTARLFFERLLDDEQYLGWFLSSLEAASLNTVPVWLLMLGIYWDSIMRYRKRGRRLAEALLEKLRQVTNPEHATTLRPLVDRLSLHIRTLVVEHTSSVILPNSWAKYKDLVLSCLNMKDNTHKAIFQNVAERNARIQLSKDRQDSGQRSPQQRVIHLFDAVCSTHDVASAAAACLKTIDDKSLLVTKLLEWTATPFRCGLCRVYTAVRLLRKWKMSGVDIDTYILSFLTRTGNRASLTMDNIYHVISELVRSQTFSVGRYLQWLMAKGVSSSNQSDHSIDLYLLKQLPMTRLPDHVRNLRNTLLYRAGVPATLEDSTIAELKASIAGRLPNIFGNEVEHTMVVESPSLDLTWAVKSEIGQWLRRGISGHCRNATSAMAGITVPADRNVSRLTPDEFYHIRDVLESFGDLSMLADVVKQTTSCDDNIVLASAADTVNYHFDSFCVIGATSDLFRSLVESYARLKRLGTPNLDLVFSLIELGLRLPQECNTVALLRQDLLRIESKSALAAPSPLSDNPSTAINEADPSFRSKLDQLLSSGGGMDESTMASIFASLTNILTGRNEDVKLSANETCRYLAYLRPFHPKHFDAMLVRWVCGLLKSSARSTMPHILPPLIGVGCVTIHAFVFLVKKLLQSERIASKIPNPARLKMDILDLLVPPAPGQSRYFDLVTYRFHLAQQEFLLKYYKETLDIICDALSTNAAAAGINSELRSSATTLLRLLLAQEPEDVVQYCLQKISAQHSTFTSVLQDTLDQLLQSVSLHDPQVSMAENVIRTTDDFSLPFCQLKLQVLSNAESKENMGDGIVDVMFKAAVADTRAKGSNWIGLVRLMSPNSVQQIRERAEKEFFAVPLFAETLGDQSLSYAPNTEALETAKLYLTIIDKLAYSIPEAGVQSVGPILVEKMDLLLHKLVVMQTSLVTRQGVVSDQATQSRANFERALAFWFSALLRMIVIHRTAFNVPSSVPRATVVQDQSRLLVSIFCISLARLPTNILRLYPTADYFPHPISSEGYRPCPGILLQTHALDVAASLIDTFPDESRQQCARFLKDKCPPFLQFQNDNRFSYLLGPVPDAGTSNIPPPASVPSPAAAAASTPTPTPSSGLPPGSSTQQASSTLSGIPTGVSEDCVASRLRLQYRGRTIGPYPVRPWELLEDAAPIVGVNDTAVNLKFFDARRVRA
Length1583
PositionKinase
OrganismAspergillus terreus (strain NIH 2624 / FGSC A1156)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Circumdati.
Aromaticity0.07
Grand average of hydropathy-0.161
Instability index50.66
Isoelectric point8.90
Molecular weight174414.73
Publications









Function






Annotated function

Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex (By similarity).



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32589
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     109.85|      27|      27|      48|      74|       1
---------------------------------------------------------------------------
   48-   74 (49.40/26.91)	PQPQLR..QPAVV...DLTTHSGDTSEREPPS
   76-  104 (26.07/10.22)	...RLRldLPSVAstgDASPASGNGEPRNTPS
 1488- 1510 (34.38/16.16)	SVP.....SPAAA...AASTPTPTPSSGLPP.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     100.24|      31|      59|    1075|    1105|       3
---------------------------------------------------------------------------
 1075- 1105 (53.10/37.19)	DLVTYRFH..LAQQEFLLKYYKETLDIICDALS
 1135- 1167 (47.13/32.13)	DVVQYCLQkiSAQHSTFTSVLQDTLDQLLQSVS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     115.71|      40|      96|     670|     711|       4
---------------------------------------------------------------------------
  468-  487 (21.53/ 8.14)	........................LLEKLRQVTNPEHATTLR.PL
  496-  525 (32.80/16.74)	RTLVVEHTSSvilPNSWAKYKDL.VLSCLNM..............
  670-  711 (61.38/49.02)	QWLMAKGVSS...SNQSDHSIDLyLLKQLPMTRLPDHVRNLRnTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.99|      13|      23|     858|     870|       6
---------------------------------------------------------------------------
  858-  870 (22.89/13.88)	DLFRSLVESYARL
  879-  891 (22.09/13.15)	DLVFSLIELGLRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.10|      17|      23|    1210|    1226|       7
---------------------------------------------------------------------------
 1210- 1226 (27.31/16.94)	GIVDVMFKAAVADTRAK
 1232- 1248 (28.79/18.25)	GLVRLMSPNSVQQIRER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.11|      19|      23|     365|     383|       8
---------------------------------------------------------------------------
  365-  383 (33.83/19.99)	GAVVIGLEAKWVREWTAHV
  389-  407 (32.28/18.74)	GLVAACGTADWKMKMTYAV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.08|      17|      26|     272|     294|       9
---------------------------------------------------------------------------
  272-  291 (24.19/25.43)	EKRQS..HNLVNaPSTfkPPPR
  297-  315 (25.89/ 8.09)	NKREAwlRDLAN.PSV..PLRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.52|      17|      26|     777|     800|      10
---------------------------------------------------------------------------
  777-  793 (30.07/31.42)	HCRNATSAMAGITVPAD
  806-  822 (28.45/12.03)	HIRDVLESFGDLSMLAD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      83.99|      21|      26|     151|     171|      11
---------------------------------------------------------------------------
  151-  169 (33.31/16.69)	.........KPASP.PPFPVLPWKYAPPE
  170-  198 (22.50/ 8.74)	AAgnksvksRDSSPaKKVQTTPYHIECPS
  199-  220 (28.18/12.91)	VA....pvlKGQKV.ADFS..PWTGNHPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      31.67|      11|      25|    1262|    1273|      18
---------------------------------------------------------------------------
 1262- 1273 (16.26/11.77)	TLGDQsLSYA.PN
 1285- 1296 (15.41/ 6.05)	TIIDK.LAYSiPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     141.46|      42|      42|    1315|    1356|      21
---------------------------------------------------------------------------
 1315- 1356 (70.78/49.71)	HKLVVMQTSLVTRQGVVSDQATQSRANFERALAFWFSALLRM
 1360- 1401 (70.68/49.63)	HRTAFNVPSSVPRATVVQDQSRLLVSIFCISLARLPTNILRL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32589 with Med12 domain of Kingdom Fungi
Unable to open file!