Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MEFSSVISQIETCLNQHLRLSTEKVNYHSVMENWSEMVHQLKNLQNLISEHTLSQELSSQIESLIEEDHALEGQIESSMKELTSIYDTTLPQNNNLKIRRKVDANTLLEYGRRLSKFSSAPPGYNPETGQDAKAPVHYPWPSEDQMRKTSLFQYSTNLIAHPSANASQILNELEETSAPSKEDTDATTSPSKKAKHAVDYTMSPTFTNATEQAETQGGESMPSSKDIFADFDLFDPEMEEDS |
Length | 242 |
Position | Middle |
Organism | Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691) (Fission yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina> Schizosaccharomycetes> Schizosaccharomycetales> Schizosaccharomycetaceae> Schizosaccharomyces. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.773 |
Instability index | 62.52 |
Isoelectric point | 4.67 |
Molecular weight | 27266.69 |
Publications | PubMed=21511999 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32582 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 151.35| 36| 41| 148| 183| 1 --------------------------------------------------------------------------- 107- 139 (48.01/26.16) ...LLEYGRRLSKFSS.APPGYNPETGQDAKAPVHYP 148- 183 (55.38/31.18) KTSLFQYSTNLIAHPS.ANASQILNELEETSAPSKED 192- 226 (47.96/26.13) KKA..KHAVDYTMSPTfTNATEQAETQGGESMPSSKD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 86.85| 29| 36| 11| 44| 2 --------------------------------------------------------------------------- 11- 44 (45.98/42.85) ETCLNQHLRLSTEkvnyhSVMENWSEMVHQ....LKNL 50- 82 (40.87/25.94) EHTLSQELSSQIE.....SLIEEDHALEGQiessMKEL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AKHAVDYTMSPTFTNATEQAETQ 2) GESMPSSKDIFADFDLFDPEMEEDS | 194 218 | 216 242 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab